Seite wählen
BIG EGO Cosmetics: LIL FAVOURITE & OH SO JELLY Testbericht

BIG EGO Cosmetics: LIL FAVOURITE & OH SO JELLY Testbericht

Gerade jetzt im Sommer sind meine Haare oft spröde, trocken und frizzig. Ist dann auch noch die Luftfeuchtigkeit hoch, ist kaum noch was zu retten und das Glätteisen ist mein liebster Freund. Da ich aber merke wie sehr es meinen Haaren schadet, bin ich schon lange auf der Suche nach einem Shampoo, das meine Haare bändigt und den Frizz vermindert. 

Auf dem Markt gibt es ein großes Angebot an Shampoos und Haarkuren, die angeblich den Frizz vermindern sollen, wie beispielsweise Frizz Ease von John Frieda oder Frizz Dismiss von Redken. Wirklich geholfen haben mir diese Produkte nicht, der Effekt hielt immer nur kurz an und schon am zweiten Tag nach der Haarwäsche sahen meine Haare aus wie vorher.

Da kam es genau richtig, dass Model und Influencerin Kristina Levina eine eigene Haarpflegeserie mit der eigenen Marke „Big Ego Cosmetics“ herausgebracht hat. Mit dabei: Ein Shampoo („lil favourite“), einen Conditioner („oh so jelly“) und jede Menge Haaraccesoires, wie beispielsweise Haarspangen in Schmetterlingsform. 

Ich habe mir gleich das Shampoo und den Conditioner bestellt, da beide Produkte aufeinander abgestimmt sein sollen und sich perfekt ergänzen sollen. Die Haare sollen nach der Haarwäsche seid weich sein, mit Feuchtigkeit gepflegt und sich samtig anfühlen. Da bin ich mal gespannt!

 

BigEgo Cosmetics

Über Big Ego Cosmetics

 

Zuallerest teile ich ein paar Infos über Big Ego Cosmetics mit euch. Die Marke wurde 2021 von Influcencerin Kristina Levina gegründet (hier kommt ihr zu ihrem Instagram Account). 

Auf der Website findet man neben dem Shampoo und dem Conditioner noch Haar-Accessoires und Haargummies. Die Website bigegocosmetics.de und auch die Produkte sind sehr „girly“ gehalten in den Farben rosa und weiß, was mir persönlich aber sehr gut gefällt. 

Alle Produkte sind tierversuchsfrei und werden innerhalb Deutschlands entwickelt, hergestellt und abgefüllt. Sie sind vegan und enthalten kein Soja. Big Ego Cosmetics vewendet keine Parabene und Sulfate und sind für alle Hauttypen verträglich. Die Produkte sind außerdem dermatologisch getestet

 

BigEgo Cosmetics
BigEgo Cosmetics

Big Ego – LIL FAVOURITE Shampoo

 

Das Shampoo LIL FAVOURITE ist ein „Balancing Shampoo for oily roots & sensitised lenghts“ und enthält 200ml. Momentan ist das Shampoo für 29,00 Euro erhältlich und zählt damit schon zu den teureren Shampoos.

Laut Big Ego Cosmetics ist die Rezeptur des Shampoos besonders mild und rein planzlichen Ursprungs. Das Shampoo enthält keine Duftstoffe, die Basis bildet Nusskernöl, Kokosöl und Maiskeimöl.

Das kann das Shampoo:

  • Weizenprotein sorgt für eine gute Kämmbarkeit und schützt vor äußeren Einflüssen wie Sonne oder Hitzeeinwirkung durch Föhnen/Glätten.
  • Papaya-Extrakt schützt ebenfalls vor Umwelteinflüssen, beruhigt die Kopfhaut und gibt Elastizität.
  • Panthenol (Vitamin B5) spendet den Haaren Feuchtigkeit, beruhigt ebenfalls die Kopfhaut sorgt für ein weiches Haargefühl.
  • Glycerin beugt Splissbildung vor und spendet Feuchtigkeit für Kopfhaut und Haare.

Des Weiteren ist das Shampoo LIL FAVOURITE vegan, silikon- und parabenfrei, PEGfrei, mineralölfrei und ohne Farbstoffe.

 

BigEgo Cosmetics
BigEgo Cosmetics
Inhaltsstoffe LIL FAVOURITE Shampoo mit Bewertung
InhaltsstoffWirkungBewertung Hautschutzengel
WasserHauptbestandteil neben waschaktiven Substanzenempfehlenswert
Sodium Cocoamphoacetate (pflanzliches Kokostensid)schaumstabilisierend, reinigend, sanftere Alternative zu Sodium Lauryl Sulfaten.empfehlenswert
Lauryl Glucoside (Tensid pflanzlichen Ursprungs) Mild und gut geeignet für empfindliche Kopfhaut. Biologisch abbaubar und umweltverträglich.empfehlenswert
Disodium Cocoyl Glutamate (Tensid pflanzlichen Ursprungs)mild und hautfreundlich, schaumbildend. Biologisch abbaubar und damit gut umweltverträglich.empfehlenswert
Sodium Lauryl Glucose Carboxylate (Tensid pflanzlichen Ursprungs)Hohe Reinigungskraft, biologisch abbaubar und gut geeignet für empfindliche Haut.empfehlenswert
Cocamidopropyl Betaine (Tensid pflanzlichen Ursprungs)Verbesert die Kämmbarkeit der Haare, wirkt antistatisch und ist gut verträglich.empfehlenswert
Glycol Distearate (Emulgator)glättend, geschmeidig machend.empfehlenswert
Coco Glucoside (Tensid pflanzlichen Ursprungs)gut schäumend, gut verträglich. Wird oft in Naturkosmetika eingesetzt.empfehlenswert
Glyceryl Oleate (Emulgator pflanzlichen Ursprungs)macht die Haare geschmeidig. Biologisch abbaubar, gut umweltverträglich.empfehlenswert
Glycerinspendet und bewahrt Feuchtigkeit, wirkt glättend.empfehlenswert
Lauryl Lactatemacht geschmeidig, bewahrt Feuchtigkeit.empfehlenswert
Carica Papaya Fruit Extract (Papaya Extrakt)pflegend, regenerierend, stärkend, antibakteriell.empfehlenswert
Hydrolyzed Wheat Protein (Weizenkeimprotein)antistatisch und feuchtigkeitsspendend.empfehlenswert
Panthenolfeuchtigkeitsbewahrend, regenerierend, beruhigend. Gut hautverträglich.empfehlenswert
Citric Acid (Zitronensäure)reguliert den pH-Wert, schützt vor Umwelteinflüssen, reduziert Frizz.empfehlenswert
Laureth-4 (PEG-Derivat)Allergie- und Reizungspotenzial, schwächt Hautbarriere,  Verunreinigung/ Bildung von Nitrosaminen möglich, die krebserregend wirken.bedenklich
Phenoxyethanol (Konservierungsmittel)Kann Hautbarriere angreifen und zu andauernden Hautreaktionen führen (Reizungen, Rötungen, Pickel, Entzündungen), Reizungs- und Allergiepotenzial, möglicherweise toxisch/ gesundheitsschädlich wirkend auf Blut und Leber. In Leave-In Produkten, die nicht abgewaschen werden, sogar verboten.bedenklich
Ethylhexylglycerin (Konservierungsmittel)Kontaktallergische Reaktionen wie Dermatitis möglichleicht bedenklich
BigEgo Cosmetics
BigEgo Cosmetics

Big Ego – OH SO JELLY Conditioner

 

Der Conditioner OH SO JELLY ist ein „strenghtening anti-breakage jelly leightweight conditioner“ und für 29,00 Euro erhältlich. Durch die „Jelly“ Textur lässt sich der Conditioner leichter verteilen, zieht schnell ein und lässt sich gut auswaschen. Besonders für trockene und strapazierte Haare ist der Conditioner gut geeignet.

Genauso wie das Shampoo enthält der Conditioner Weizenprotein, Glycerin, Panthenol und Papaya-Extrakt. Außerdem ist der Conditioner silikon- und parabenfrei, PEGfrei, tierversuchsfrei, mineralölfrei, vegan und ohne Farbstoffe.

Da der Conditioner sehr konzentriert ist, reicht wenig Produkt aus. Dieses wird in die nassen Haare eingearbeitet und nach kurzer Einwirkzeit wieder ausgespült.

BigEgo Cosmetics
BigEgo Cosmetics
Inhaltsstoffe Oh so jelly
InhaltsstoffWirkungBewertung Hautschutzengel
AquaHauptbestandteil neben pflegenden Substanzenempfehlenswert
Cetyl AlcoholKonsistenzgeber, sorgt für geschmeidiges Haarempfehlenswert
Behentrimonium Chloridesorgt für glänzendes, weiches Haar und gute Kämmbarkeitleicht bedenklich
Carica Papaya Fruit Extract (Papaya Extrakt)pflegend, regenerierend, stärkend und antibakteriellempfehlendwert
Hydrolyzed Wheat Protein (Weizenkeimoritein)antistatisch und feuchtigkeitsspendendempfehlenswert
Panthenolregenerierend, beruhigend, gut hautverträglichempfehlenswert
Parfum (Duftstoff)sorgt für angenehmen Duftunbekannt
Limonene (Duftstoff pflanzlichen Ursprungs)sorgt für angenehmen Duftempfehlenswert
Citronellol (Duftstoff pflanzlichen Ursprungs)sorgt für angenehmen Duftempfehlenswert
alpha-isomethyl Ionone (Duftstoff synthetischen Ursprungs)kann allergie Reaktion hervorrufen und die Haut irritieren, umweltrelevantleicht bedenklich
Citric Acid (Zitronensäure)reguliert den pH-Wert, schützt vor Umwelteinflüssen, reduziert Frizzempfehlenswert
PhenoxyethanolKann die Hautbarriere angreifen und zu andauernden Hautreaktionen führen (Reizungen, Rötungen, Pickel, Entzündungen), Allergiepotenzial, möglicherweise toxisch/ gesundheitsschädlichbedenklich
Ethylhexylglycerin (Konservierungsmittel)Kontaktallergische Reaktionen wie Dermatitis möglichleicht bedenklich

 

Kleiner Hinweis: Viele Inhaltsstoffe, die als „empfehlenswert“ eingestuft sind, können trotzdem ein leichtes bis hohes Allergierisiko aufweisen. Am besten einfach nachlesen, wenn bei einem Inhaltsstoff Unsicherheit besteht, da ich es nicht zu jedem einzelnen herausgesucht habe!

BigEgo Cosmetics

Big Ego Cosmetics – Produkttest

So, nachdem ich so viel über das Shampoo und den Conditioner von Big Ego berichtet habe, möchte ich natürlich auch zeigen, wie meine Haare nach dem Waschen mit den Big Ego Produkten aussehen.

Dafür habe ich meine Haare einmal vor dem Waschen fotografiert, dann nach dem Waschen mit meinem üblichen Shampoo aus der Drogerie und dann nach der Haarwäsche mit den Produkten von Big Ego.

1. Foto: Vor der Haarwäsche

2. Foto: Nach der Haarwäsche mit einem normalen Shampoo

3. Foto: Nach der Haarwäsche mit den Big Ego Produkten (Shampoo und Conditioner)

Haare vor dem Waschen
Nach dem Haarewaschen
Nach dem Haare waschen mit Big Ego

Ich finde man kann gut erkennen, dass die Produkte von Big Ego einen Unterschied machen, wenn auch keinen allzu großen. Aber der große Unterschied kommt warscheinlich eher mit regelmäßiger Anwendung, daher werde ich nochmal berichten, nachdem ich die Produkte einige Wochen angewendet habe.

Nach der Haarwäsche mit einem normalen Shampoo sind meine Haare total „aufgeplustert“, strohig und sehr trocken. Die Spitzen fühlen sich fast schon strohig an und allgemein sind die Haare sehr buschig. 

Nach der Anwendung mit den Prokten von Big Ego Cosmetics sind meine Haare weniger buschig, fühlen sich weicher an und sind auch etwas glatter.

Meine Erfahrung mit Big Ego Cosmetics

 

Ich finde das Shampoo und den Conditioner richtig gut! Fast gar keine schädlichen Inhaltsstoffe, viele pflegende Komponenten und sogar keine Duftstoffe im Shampoo. Das geht schon fast in Richtung Naturkosmetik.

Da der Conditioner Duftstoffe enthält (unter anderem Citrusduft), riechen die Haare nach der Anwendung trotzdem sauber und frisch. Und genau so fühlen sie sich auch an! Beim Shampoo ausspülen „quietschen“ sie richtig (was sie bei mir nicht bei jedem Shampoo machen) und nach dem Föhnen sind sie glatter und weniger frizzig als sonst. Das Shampoo riecht übrigens wirklich nach nichts, dafür hat der Conditioner einen angenehmen fruchtigen Duft. 

Etwas teuer finde ich den Preis, für beides zusammen zahlt man 60 Euro, eine Flasche enthält jedoch nur 200ml und reicht besonders bei langen Haaren nicht allzu lange. Aber da die Marke gerade erst am Anfang steht, ändert sich der Preis ja vielleicht auch noch.

10 von 10 Punkten würden die beiden Produkte bekommen, wenn auch für die schädlichen Inhaltsstoffe geeignete Alternativen verwendet worden wären.

Das Design gefällt mir übrigens sehr gut, schön schlicht, clean und trotzdem ansprechend.

Meine Haare sehen zwar nicht aus wie nach dem Friseur, aber ich freue mich, dass wenigstens ein kleiner Unterschied erkennbar ist. Ob der Unterschied nach regelmäßiger Anwendung noch größer wird und meine Haare insgesamt noch weniger frizzig sind, werde ich berichten. 🙂 

Hier ist nochmal der Link zum Shop: bigegocosmetics.de.

BigEgo Cosmetics
BigEgo Cosmetics

Neben dem Shampoo und dem Conditioner habe ich mir noch ein paar Scrunchies dazu bestellt. Die Farben gefallen mir mega gut und da die Scrunchies aus Seide sind, sehen sie schick und edel aus und sind gut für die Haare. Es entsteht weniger Haarbruch und die Haare werden geschont.

Big Ego Cosmetics
Big Ego Cosmetics

Die Scrunchies sind übrigens in hübschen kleinen, wiederverschließbaren Tütchen verpackt, was zwar süß aussieht, aber ob die Tütchen auch nicht vermeidbarer Verpackungsmüll sind? 

Big Ego Cosmetics
Big Ego Cosmetics

Besonders das große, weiße seidene Scrunchie finde ich besonders schön und es erinnert mich an eine elegante Hochzeit in weiß. Ich trage es oft im Büro und habe ein paar Fotos zur Inspiration gemacht, mit welchen Frisuren man das Scrunchie tragen kann. 🙂 

Big Ego Cosmetics
Big Ego Cosmetics

» Hier findest du die Scrunchies von Big Ego:

Silk Scrunchie groß (20 Euro) und

Silk Scrunchie klein 5er-Pack (25 Euro)

 

 

» Günstigere Alternativen von Amazon:

Silk Scrunchie groß (10 Euro) und

Silk Scrunchie klein 2er-Pack (13 Euro)

Pam Box Juni 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pam Box Juni 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pamela Reif, eine deutsche Fitness-Influencerin mit mehr als 6,5 Millionen Followern auf Instagram, hat Ende 2019 in Zusammenarbeit mit Foodist, bekannt für Abonnement-Lebensmittel-Boxen, die Pam-Box herausgebracht. Die  Pam-Box bringt dich auf eine vegane Entdeckungsreise und man kann super neue Produkte entdecken und ausprobieren. Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Ich habe die Box schon einige Male erhalten und mich nun entschlossen, über den Inhalt und meine Meinung dazu zu berichten. Am Anfang war ich von der Box total begeistert, aber zwischendurch war auch die ein oder andere Box dabei, deren Inhalt und auch das Preis-Leistungs-Verhältnis mich nicht ganz überzeugt haben. Hast du die Pam-Box auch schon ausprobiert und was hältst du allgemein von Lebensmittel-Boxen? Schreib es mir gerne in die Kommentare!

Konzept und Inhalt der Pam-Box

In jeder Pam-Box sind 6 bis 8 Produkte enthalten, darunter neben Superfood-Snacks, High-Protein-Riegel und Lebensmitteln zum Kochen auch Küchenutensilien oder nachhaltige Produkte, wie Bambus-Küchentücher oder Glas-Strohhalme. Der Gesamtwert der Box liegt laut Foodist bei mindestens 32 Euro. Die Pam Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Alle Produkte in der Pam-Box sind:

  • aus natürlichen Zutaten
  • 100 Prozent vegan
  • ohne raffinierten Zucker 
  • ohne künstliche Geschmacksverstärker
  • von Pamela getestet und empfohlen.

Zusätzlich enthält jede Box ein kleines Booklet rund um die Produkte, persönliche Tipps von Pamela und Rezepte.

Pam Box Juni 2021
Pam Box Februar 2021

Was kostet die Pam-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

 

Geheimtipp: Die Pam-Box kannst du verschenken! Hier wählst du zwischen Laufzeiten von 1 bis zu 12 Monaten, das Abonnement wird nach Ablauf nicht verlängert! So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. Wenn du die Box lieber selbst übergeben möchtest, kannst du aber auch deine eigene Adresse angeben.

Und pssst…wenn du die Pam-Box selber ausprobieren möchtest ohne ein Abo abzuschließen, dann wähle einfach die Geschenk-Option und bestell die Box zu dir nach Hause.

 

Wie häufig wird die Pam-Box geliefert?

Die Pam-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

Inhalt der Pam Box Juni 2021

Die Pam Box von Juni 2021 enthält folgende 6 Produkte:

Damit liegt der Gesamtwert der Pam Box Juni 2021 bei  34,50 Euro und übersteigt damit den Mindest-Gesamtwert der Box, welcher bei 32 Euro liegt.

 

Pam Box Juni 2021
Pam Box Juni 2021

PAKKA Bio Cashews geröstet mit Meersalz

 

Leicht gesalzene Cashewkerne als gesunder Snack für zwischendurch. Mag ich persönlich total gerne!

  • Inhalt: 100g
  • fair gehandelt aus Burkina Faso
  • mit Meersalz gesalzen

Zutaten: Cashews 98.7%, Salz 1.2%, Gummi Arabicum.

Hier nach den Cashews stöbern:

Foodist Pakka Cashews

➤ Alternative: Bio Fairtrade Cashewkerne mit Curry & Meersalz

Pam Box Juni 2021

YOGI TEA Bio Teekaltgetränk Ingwer & Zitrone

 

Den Yogi Tea Ingwer&Zitrone kannte ich vorher nur als „normalen“ Tee und war echt (positiv) überrascht, dass es den Tee auch als Kaltgetränk gibt! Sehr erfrischend und passt perfekt für heiße Sommertage 🙂 

  • Inhalt: 330 ml
  • mit Zitronengras, Hibiskus und Krauseminze
  • ohne Zusatzstoffe

Zutaten: Aufguss von Kräutern und Gewürzen (Wasser, Ingwer*, Süßholz*, schwarzer Pfeffer*, Pfefferminze*, Zitronenschale*, Zitronengras*, Hibiskus*, Krauseminze*)(92,5%), Agavendicksaft* (4,5%), Zitronensaft* (2,5%), Ingwersaft* (0,5%).
*aus kontrolliert biologischem Anbau

Hier nach dem Yogi Tea stöbern:

Foodist Yogi Tea 

➤ Alternative: Carpe Diem Kombucha Zitrone-Ingwer

 

Pam Box Juni 2021

BLUE FARM Haferdrink Pulver

 

Haferdrink zum selber anrühren? Das habe ich sofort ausprobiert und es klappt echt gut! Das Pulver ist sehr ergiebig und reicht für bis zu 4 Liter. Super daran finde ich, dass diese Alternative zu Hafermilch in Verpackungen viel Verpackungsmüll spart und umweltfreundlich ist.

  • Inhalt: 375g
  • gluten- und laktosefrei
  • ohne Zucker

Zutaten: Hafer, Salz.

 

Hier nach dem Haferdrink Pulver stöbern:

Foodist Haferdrink Pulver

➤ Alternative: AlpenPower BIO TRINKHAFER

Pam Box Juni 2021

CLEVER PASTA Rote Linsen Nudeln

 

Nudeln mag ich, rote Linsen weil sie so gesund sind auch – deshalb habe ich mich eigentlich über die Rote Linsen Nudeln gefreut. „Eigentlich“ deshalb, weil in der letzten Pam Box von April 2021 schon Nudeln drin waren und ich meine mich zu erinnern, kein Nudel-Abo bestellt zu haben..naja aber gottseidank kann man gute Pasta ja immer gebrauchen! 🙂

  • Inhalt: 250g
  • glutenfrei und proteinreich
  • in nur 4 Minuten fertig

Zutaten: Rotes Linsenmehl (89%), Wasser.

Hier nach der Rote Linsen Pasta stöbern:

Foodist Rote Linsen Pasta

➤ Alternative: Barilla Fussili Rote Linsen

Pam Box Juni 2021

BAETTER BAKING Bio Backmischung für Haferkekse

 

Diese Pam Box regt wirklich zum Selbermachen kann – neben Hafermilch zum selbst anrühren ist nun eine Backmischung für Haferkekse dabei (ich glaube bei der Auswahl hat Pam der Hafer gestochen :D). Spaß beiseite: Die Backmischung ist perfekt, wenn’s man schnell gehen muss und man trotzdem gerne etwas selbst gebackenes haben möchte. Und gesund noch dazu! Aber aufpassen: Bananen, Ahornsirup und Öl musst du selbst dazugeben.

  • Inhalt: 300g (reicht für 18-20 Kekse)
  • glutenfrei und vegan
  • mit natürlicher Süße

Zutaten: Hafervollkornmehl* (41*), Hafervollkornflocken* (21%), Kokosraspeln* (13%), Dattelwürfel* (Datteln*, Reismehl*), Leinsaat*, Mandeln* (5%), Kürbiskerne* (5%), Zimt*, Meersalz.
*aus kontrolliert biologischem Anbau

Hier nach der Haferkeks-Backmischung stöbern:

Foodist Haferkeks Backmischung

➤ Alternative (für alle die sofort Knuspern wollen): Bauckhof Bio Hafercookies

Kleiner Tipp: Beim Stöbern auf baetterbaking.com habe ich noch weitere Backmischungen entdeckt, die du sogar bei Amazon bestellen kannst, beispielsweise die glutenfreie Pancakes-Backmischung und die Brownie-Backmischung mit Kokosblütezucker.

Pam Box Juni 2021

3BEARS Overnight Oats Glas

 

Das Overnight Oats Glas kommt gerade richtig für ein leichtes, gesundes Frühstück im Sommer, am Abend zubereitet und morgens verzehrfertig aus dem Kühlschrank. Ich bin totaler Fan davon und hab gleich mein Lieblingsrezept ausprobiert – Overnight Oats mit frischen Erdbeeren und Rohkakao-Topping (noch aus der Pam Box von April). So lecker!

  • umfasst 410 ml
  • mit Deckel, spülmaschinenfest
  • perfekt zum Mitnehmen
  • mit Füllstrichen, um das richtige Verhältnis von Haferflocken und Flüssigkeit abzupassen

Jetzt nach dem Overnight Oats Glas stöbern:

Foodist Overnight Oats Glas 

➤ Alternative von Amazon: Kilner Frühstück To-Go-Glas

Pam Box Juni 2021

Meine Meinung zur Pam Box Juni 2021 – lohnt sie sich?

 

Meine Meinung zur Pam Box Juni 2021 ist tatsächlich etwas zwiegespalten. Einerseits sind super gesunde Alternativen zu herkömmlichen Süßigkeiten dabei, so wie die Backmischung für die Haferkekse und die Cashewnüsse. und besonders das Haferdrink-Pulver hat es mir angetan, da es nur aus zwei Zutaten besteht und Verpackungsmüll spart.

Andererseits hätten die Rote Linsen Nudeln nicht sein müssen (meine persönliche Meiung), da in der Pam Box von April 2021 schon eine große Packung Kichererbsen-Nudeln drin war. Da hätte ich mir mehr Abwechslung gewünscht! Vielleicht startet Pam ja eine heimliche Kampagne für Nudeln aus Hülsenfrüchten und gegen Getreide-Nudeln 😀

Über das Overnight Oats Glas habe ich mich sehr gefreut, da ich gerne Porridge esse und dieses auch oft zur Arbeit mitnehme, bisher immer in alten Marmeladengläsern. Das Glas von 3Bears sieht dann aber doch schicker aus und gerade die Füllstriche finde ich total praktisch, um das richtige Verhältnis von Haferflocken und Flüssigkeit zu treffen. Nur den Preis von fast 8 Euro finde ich dann doch etwas viel für ein Glas mit Deckel.

 

Naturata Produkttest: vegane Salatcreme, Aioli und Senf im Geschmackstest!

Naturata Produkttest: vegane Salatcreme, Aioli und Senf im Geschmackstest!

Dieses Frühjahr durfte ich im Rahmen vom eve-Produkttest drei Produkte von der biologischen Lebensmittel-Marke Naturata testen und bewerten: die „Vegane Aioli“, die „Vegane Salatcreme“ und den „Körnigen Senf“(keine Werbung!).

Wie mir die drei Würzklassiker gefallen haben, berichte ich dir hier. Viel Spaß! 🙂

Über die Bio-Marke Naturata

 

Die Marke Naturata steht für biologische und nachhaltig erzeugte Lebensmittel mit höchsten Qualitäts-Standards. Die Produkte sind größtenteils Demeter- und Fairtrade zertifiziert. Bei der Herstellung der Lebensmittel wird darauf geachtet, dass diese möglichst ressourcenschonend ist.

 

Demeter-Produkte

 

Mehr als die Häfte der Produkte von Naturata sind Demeter-zertifiziert, wie beispielsweise der Getreide-Kaffee, die Hartweizen-Spirelli und das Olivenöl. Das bedeutet, dass die strengen Demeter-Richtlinien erfüllt und die Einhaltung regelmäßig kontrolliert wird. Demeter-Betriebe garantieren einen biologisch-dynamischen Anbau- und Verarbeitungsprozess. Unter anderem werden chemisch-synthetische Dünge- und Pflanzenschutzmittel weggelassen und auf die Verwendung von gekreuztem Saatgut (Hybriden) verzichtet.

Stattdessen wird dem Boden zur Qualitätssteigerung ein spezieller Kompost hinzugefügt, um die Fruchtbarkeit des Bodens zu steigern und das Wurzelwachstum der Pflanzen anzuregen.

Auch in der Weiterverarbeitung der Ernte gibt es strenge Vorschriften, unter anderem ist die Verwendung von Nitritpökelsalz, Jod und natürliche Aromen verboten.

Auch was die Tierhaltung betrifft gelten bestimmte Regeln. Beispielsweise darf das Tierfutter keine Hormone und Antibiotika enthalten und muss entweder vom eigenen Hof, oder von einem anderen Demeter-zertifizierten Hof stammen. 

Bei Interesse findest du hier weitere Informationen zu der Demeter-Zertifizierung und den Richtlinien.

Auch die drei Würzklassiker, die ich testen durfte, sind übrigens Demeter-zertifiziert! 🙂

myclimate – klimaneutrale Produktion

 

Die internationale Klimaschutzorganisation myclimate steht für CO2-Kompensationsmaßnahmen und Klimaschutzprojekte für ein umweltfreundlicheres Handeln. Über die drei Säulen Vermeidung, Reduktion und Kompensation sollen die klimaschützenden Maßnahmen vorangetrieben werden.

Seit 2011 achtet Naturata auf eine Kompensation von CO2-Ausstoß. Mittlerweile wird in Zusammenarbeit mit myclimate bei vielen Produkten der gesamte CO2-Ausstoß von der Herstellung bis zum Transport kompensiert.

Das Besondere an den Klimaschutzprojekten ist, dass Wert darauf gelegt wird, die Lebensbedingungen der Bevölkerung vor Ort zu verbessern. Beispielsweise werden mit dem Kauf der Naturata-Schokoladen die Haushalte in Peru unterstützt und mit modernen Kaminen versorgt, die den Rauch aus den Häusern ableiten.

Toll: Auf der Verpackung des Produktes kannst du mit einem Link genau nachverfolgen, welches Klimaschutzprojekt mit dem Produkt unterstützt wird!

 

Fairtrade und nachhaltige Produkte

 

Naturata legt bei der Herstellung der Produkte Wert auf faire Handelsbeziehungen – dies kannst du an dem Fairtrade-Siegel auf dem jeweiligen Produkt erkennen.

Damit möglichst wenig weggeworfen wird, werden Überproduktionsmengen oder Produkte, die nahe am Mindesthaltbarkeitsdatum sind, an gemeinnützige Vereine und Organisationen weitergegeben.

An dem FSC-Siegel erkennst du, dass die Verpackung nachhaltig und umweltschonend ist.

 

Naturata
Naturata Vegane Salatsauce

Naturata Vegane Salatcreme im Test

 

Die Vegane Salatcreme ohne Ei kommt in einer fröhlich-gelben Tube, die mit einem Demeter-Kennzeichen versehen ist. Außerdem ist die Salatcreme mit dem EU-Bio-Siegel gekennzeichnet. Enthalten sind 180g bzw. 190 ml.

Dies sind die Zutaten:

Sonnenblumenöl**, Wasser, Senf (Wasser, Senfkörner**, Branntweinessig*, Apfelessig**, Meersalz, Roh-Rohrzucker**, Curcuma*), Branntweinessig*, Roh-Rohrzucker**, Maisstärke*, Zitronensaft**, Sonnenblumeneiweiß*, Meersalz, Verdickungsmittel: Johannisbrotkernmehl*, Guarkernmehl* [*aus kontrolliert biologischem Anbau; **aus biodynamischer Erzeugung (Demeter)]

Nährwerttabelle

Durchschnittliche Nährwertepro 100g
Energie2150 kJ/ 522 kcal
Fett55,0g
davon gesättigte Fettsäuren6,1g
Kohlenhydrate5,1g
davon Zucker2,6g
Eiweiß0,7g
Salz1,1g
Naturata Vegane Salatcreme
Naturata Vegane Salatcreme

Bewertung Vegane Salatcreme

 

Wenn ich Sterne vergeben müsste, würde die Vegane Salatcreme ohne Ei von Naturata 10 von 10 Sternen bekommen. Sie schmeckt sehr lecker, ist cremig in der Konsistenz und ich merke keinen Unterschied zu einer „normalen“ Mayonnaise.

Die Vegane Salatcreme lässt sich super kombinieren, beispielsweise mit knusprigen selbst gemachten Pommes oder in einem würzigen Nudelsalat. Ich als Nicht-Veganerin habe die Vegane Salatcreme ohne Ei – mit einem Ei gegessen (siehe Fotos) und war wirklich begeistert.

Dass die Vegane Salatcreme in einer Tube enthalten ist und nicht in einem Glas, finde ich hinsichtlich der Hygiene sehr gut, da sich die Salatcreme sauber entnehmen lässt. Außerdem kann man so auch gut dosieren.

Übrigens enthält die Vegane Salatcreme weniger Öl als die Mayonnaise von Naturata und ist somit eine tolle kalorienärmere Alternative!

Aktuell ist die Vegane Salatcreme im Onlineshop von Naturata von 2,79 Euro auf 2,51 Euro reduziert (klicke hier, um zum Produkt zu gelangen).

 

➤ Im Geschäft vor Ort kaufen: Reformhaus Bacher, Denns BioMarkt, Alnatura Super Natur Markt, Bio Company und LPG Biomarkt

Unter www.ladensuche.naturata.de kannst du online mit einem Klick nachschauen, in welchem Biomarkt in deiner Region die Vegane Salatcreme erhältlich ist!

 

➤ Im Onlineshop bestellen (klick auf den Link): Naturata, Reformhaus Bacher, vekoop, violey, hallo-vegan, greenist und Reformhaus Riedel

Ich habe dir noch einige Alternativen verlinkt:

 

Naturata Vegane Salatsauce
Naturata Körniger Senf

Naturata Körniger Senf im Test

Der Körnige Senf von Naturata befindet sich ebenfalls in einer Tube, welche in den Farben blau und beige gehalten ist. Das Produkt ist mit dem Demeter-Siegel versehen und enthält zusätzlich weitere Informationen („langjährige Partnerschaft“, „aus schweizer Herstellung“, „veganes Produkt“, „klimaneutrales Produkt“).

Des Weiteren ist der Körnige Senf mit dem Bio-EU-Siegel ausgezeichnet sowie mit dem myclimate-Logo.

Die Tube beinhaltet 90g bzw. 100ml und ist somit kleiner als die Vegane Salatcreme.

Dies sind die Zutaten:

Wasser, Senfsaat gelb und schwarz**, Branntweinessig*, Apfelessig**, Meersalz, Rohrohrzucker**, Pfeffer*, Koriander*, Paprika*, Kurkuma* [*aus kontrolliert biologischem Anbau; **aus biodynamischer Erzeugung (Demeter Anteil 69%)].

Nährwerttabelle:

Durchschnittliche Nährwertepro 100g
Energie467kJ/ 112 kcal
Fett7,8g
davon gesättigte Fettsäuren0,6g
Kohlenhydrate6,2g
davon Zucker2,0g
Eiweiß6,6g
Salz3,2g

 

Naturata Körniger Senf
Naturata Körniger Senf

Bewertung Körniger Senf

 

Dem Körnigen Senf von Naturata würde ich 7 von 10 Sternen geben. Die Konsistenz ist schön körnig, eben so wie der Name sagt. Im Geschmack ist der Körnige Senf sehr würzig und für mein Empfinden etwas zu sauer, man schmeckt und riecht den enthaltenen Essig deutlich. Daher leider keine volle Punktzahl.

Ich habe den Körnigen Senf mit unterschiedlich kombiniert, erst mit einem Tofuwürstchen und an einem anderen Tag mit einem normalen Bratwürstchen und zu beiden hat er sehr gut gepasst.

Bezüglich der Verpackung hätte ich mir passend zum Senf eine gelbe Farbe gewünscht. Die o.g. zusätzlichen Informationen auf der Verpackung sind jedoch super!

Aktuell ist der Senf im Naturata Online-Shop von 1,59 Euro auf 1,43 Euro runtergesetzt (klicke hier). Den Preis finde ich angemessen und passend für ein Bio-Produkt.

 

➤ Im Onlineshop bestellen (klick auf den Link):  naturata, violey, naturkost.com und Amazon

Unter www.ladensuche.naturata.de kannst du online mit einem Klick nachschauen, in welchem Biomarkt in deiner Region der Körnige Senf erhältlich ist!

Ich habe dir noch einige Alternativen verlinkt:

Naturata
Naturata Veganes Aioli

Naturata Vegane Aioli im Test

 

Die Vegane Aioli von Naturata kommt in einer zart-rosa Tube mit einer aufgedruckten Knoblauchknolle. Neben dem Demeter- Siegel, dem EU-Bio-Siegel und dem myclimate-Logo enthält die Verpackung genauso wie der Senf noch weitere Informationen zum Produkt:

  • langjährige Partnerschaft
  • aus schweizer Herstellung
  • veganes Produkt
  • klimaneutrales Produkt.

Diese Informationen sind diesmal sogar auf beiden Seiten aufgedruckt. Die Tube enthält 185g bzw. 190ml.

Dies sind die Zutaten:

Sonnenblumenöl**, Wasser, Branntweinessig*, Meersalz, Roh-Rohrzucker**, Senf** (Wasser, Senfsaat**, Branntweinessig*, Meersalz, Roh-Rohrzucker**, Curcuma*), Knoblauch 1,7%*, Meersalz, Sonnenblumenprotein*, Maisstärke*, Zitronensaft**, Verdickungsmittel (Guarkernmehl*, Johannisbrotkerhmehl*), Curcuma* [*aus kontrolliert biologischem Anbau; ** aus biodynamischer Erzeugung (Demeter)].

Nährwerttabelle

Durchschnittliche Nährwertepro 100g
Energie2482 kJ/ 502 kcal
Fett64g
davon gesättigte Fettsäuren5,0
Kohlenhydrate5,2
davon Zucker4,0
Eiweiß0,7
Salz1,3

 

Naturata Vegane Aioli

Bewertung Vegane Aioli

 

Die Vegane Aioli von Naturata ist mein Favorit von den drei Würzklassikern und erhält von mir 10 von 10 Sternen. Die Konsistenz ist schön cremig und die Aioli lässt sich aus der Tube super dosieren. Geschmacklich erinnert die Vegane Aioli an die Vegane Salatcreme mit einer dezenten Knoblauchnote (bis auf den Knoblauch sind die Zutaten auch exakt gleich) und schmeckt gleichzeitig würzig, aber mild.

Ich habe die Vegane Aioli als Dip zu selbstgemachten Süßkartoffel-Pommes kombiniert (siehe Fotos). Für Knoblauch-Liebhaber könnte die Vegane Aioli noch einen etwas kräftigeren Knoblauch-Geschmack haben, andererseits ist auch gerade die dezente, milde Note sehr angenehm.

Den Preis für die Vegane Aioli in Höhe von 2,99 Euro (aktuell runtergesetzt auf 2,69 Euro) finde ich für die Menge etwas teuer, aber nicht ungewöhnlich für ein Bio-Produkt dieser Qualität.

 

➤ Im Onlineshop kaufen (klick auf den Link): Naturata, bioaufvorrat, violey und amorebio.

Unter www.ladensuche.naturata.de kannst du online mit einem Klick nachschauen, in welchem Biomarkt in deiner Region die Vegane Aioli erhältlich ist!

 

Hier habe ich dir Alternativen verlinkt:

Fazit Naturata Produkttest

 

Alle drei Würzklassiker von Naturata schmecken sehr lecker, haben eine schöne cremige Konsistenz und stehen den nicht veganen Produkten in nichts nach. Mein persönlicher Favorit ist die Vegane Aioli mit der milden Knoblauchnote.

Besonders praktisch finde ich, dass alle drei Würzsaucen in Tuben verpackt sind. Dadurch lassen sie sich leicht dosieren, bleiben hygienisch und halten sich länger, da nicht viel Luft an die Produkte kommen. Somit sind keine zusätzlichen Konservierungsstoffe notwendig.

Alle Zutaten sind in biologischer oder Demeter-Qualität und entsprechen damit höchsten Qualitätsstandards.

Die Preise mit 2-3 Euro je Produkt sind höher als bei Discounter-Produkten, entsprechen aber der üblichen Preishöhe in der Bio-Branche.

Zusammengefasst kann ich die drei Würzklassiker „Vegane Salatsauce“, „Körniger Senf“ und „Vegane Aioli“ nur weiterempfehlen und würde sie mir auch selbst wieder kaufen.

 

Pam Box April 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pam Box April 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pamela Reif, eine deutsche Fitness-Influencerin mit mehr als 6,5 Millionen Followern auf Instagram, hat Ende 2019 in Zusammenarbeit mit Foodist, bekannt für Abonnement-Lebensmittel-Boxen, die Pam-Box herausgebracht. Die  Pam-Box bringt dich auf eine vegane Entdeckungsreise und man kann super neue Produkte entdecken und ausprobieren. Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Ich habe die Box schon einige Male erhalten und mich nun entschlossen, über den Inhalt und meine Meinung dazu zu berichten. Am Anfang war ich von der Box total begeistert, aber zwischendurch war auch die ein oder andere Box dabei, deren Inhalt und auch das Preis-Leistungs-Verhältnis mich nicht ganz überzeugt haben. Hast du die Pam-Box auch schon ausprobiert und was hältst du allgemein von Lebensmittel-Boxen? Schreib es mir gerne in die Kommentare!

Diese Beiträge könnten dich auch interessieren:

Inhalt Pam Box Oktober 2020

Inhalt Pam Box Dezember 2020

Inhalt Pam Box Februar 2021

Konzept und Inhalt der Pam-Box

In jeder Pam-Box sind 6 bis 8 Produkte enthalten, darunter neben Superfood-Snacks, High-Protein-Riegel und Lebensmitteln zum Kochen auch Küchenutensilien oder nachhaltige Produkte, wie Bambus-Küchentücher oder Glas-Strohhalme. Der Gesamtwert der Box liegt laut Foodist bei mindestens 32 Euro. Die Pam Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Alle Produkte in der Pam-Box sind:

  • aus natürlichen Zutaten
  • 100 Prozent vegan
  • ohne raffinierten Zucker 
  • ohne künstliche Geschmacksverstärker
  • von Pamela getestet und empfohlen.

Zusätzlich enthält jede Box ein kleines Booklet rund um die Produkte, persönliche Tipps von Pamela und Rezepte.

Pam Box April 2021
Pam Box April 2021
Pam Box April 2021

Was kostet die Pam-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

 

Geheimtipp: Die Pam-Box kannst du verschenken! Hier wählst du zwischen Laufzeiten von 1 bis zu 12 Monaten, das Abonnement wird nach Ablauf nicht verlängert! So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. Wenn du die Box lieber selbst übergeben möchtest, kannst du aber auch deine eigene Adresse angeben.

Und pssst…wenn du die Pam-Box selber ausprobieren möchtest ohne ein Abo abzuschließen, dann wähle einfach die Geschenk-Option und bestell die Box zu dir nach Hause.

 

Wie häufig wird die Pam-Box geliefert?

Die Pam-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

Inhalt der Pam Box April 2021

Die Pam Box von April 2021 enthält folgende 6 Produkte:

Damit liegt der Gesamtwert der Pam Box April 2021 bei  32 Euro und erreicht damit exakt den Mindest-Gesamtwert der Box, welcher bei 32 Euro liegt.

Elimba Rohkakao Topping
Elimba Rohkakao Topping

ELIMBA Bio Rohkakao Topping

 

Perfektes Topping für Porridge, Müsli oder Granola. Aber Vorsicht: besser langsam rantasten, da das Rohkakao Topping ziemlich bitter ist (aber dafür umso gesünder!).

  • Inhalt: 150g
  • bestehend aus Criollo-Kakao
  • herber und intensiver Geschmack
  • ohne: Konservierungsstoffe, Palmöl, Zusatzstoffe
  • vegan, glutenfrei und laktosefrei

Zutaten: Edelkakaomassse*, Kokosblütenzucker*, Kokosblütensirup*, Agavendicksaft*, Kurkuma*, Zimt*, Ingwer*, Muskat, *, Kardamom*, Pfeffer*, Salz*, Orangen-Essenz*.
*aus kontrolliert Biologischem Anbau

Jetzt nach dem Topping stöbern:

Foodist Rohkakao Topping (6,95 Euro)

➤ Alternative von Amazon: Bio Rohkakao Kakaonibs (4,95 Euro)

Elimba Rohkakao Kugel
Elimba Rohkakao Kugel

ELIMBA Bio Kakao-Kugel

Handgeformter Kakao-Ball, mit dem sich im Nu ein leckerer Kakao zaubern lässt! Obwohl Kakao-Ball nicht ganz stimmt, die „Kugel“ sieht nämlich eher aus wie ein Törtchen, was dem Geschmack aber keinen Abbruch tut.

  • Inhalt: 50g
  • besteht aus Criollo-Rohkakao und leckeren Gewürzen
  • kann für heißen und kalten Kakao benutzt werden
  • vegan, glutenfrei und laktosefrei

Zutaten: Edelkakaomasse*, Kokosblütenzucker*, Kokosblütensirup*, Agavendicksaft*, Salz*, Chili*, Tonkabohne*, Kardamom*, Zimt*, Muskatnuss*.
*aus kontrolliert biologischem Anbau

Jetzt online stöbern:

Foodist Elimba Kakao Kugeln (1er Pack für 3,50 Euro)

Amazon Elimba Kakao Kugeln (3-er Pack für 8,50 Euro)

Pam Box April 2021
Pam Box April 2021

MY RAW JOY Bio Choco Bar Caramel

 

Leckerer Karamell-Riegel ohne raffinierten Zucker. Die Schokolade schmeckt schön herb und übertönt aber leider etwas das Karamell, welches sich im Inneren des Riegels befindet und angenehm weich ist.

  • Inhalt: 30g
  • mit peruanischem Kakao und Kokospalmzucker
  • roh zubereitet
  • ohne Konservierungsstoffe und Zusatzstoffe

Zutaten: Schokolade* (53,3%) (Kakaobutter*, Kokosnusszucker*, rohes Kakaopulver*, Cashewnüsse*, Bourbon-Vanille*, Salz, Mandeln*, Haselnüsse*), Carawmel-Füllung (46,7%) (Cashewnüsse*, Mandeln*, Kokosnusszucker*, Bourbon-Vanille*).
*aus kontrolliert biologischem Anbau

Jetzt online stöbern:

Foodist My Raw Joy Karamellriegel (2,75 Euro)

Amazon My Raw Joy Karamell Cookie (2,79 Euro)

Pam Box Kichererbsen Nudeln
Pam Box Kichererbsen Nudeln

PASTAKULTUR BIO Kichererbsen Pasta

 

Leckere Alternative zu industriell gefertigten Nudeln. Sind super schnell fertig und man bekommt easy eine gute Portion pflanzliche Proteine.

  • Inhalt: 250g
  • enthält viele wertvolle Ballaststoffe
  • glutenfrei

Zutaten: Kichererbsenmehl* (100%). *aus kontrolliert biologischem Anbau.

Jetzt online stöbern:

Foodist Kichererbsen Pasta (4,50 Euro)

Alternative bei Amazon: Bio Kichererbsen Pasta (3,93 Euro)

Eat Real Pam Box Hummus Chips
Eat Real Pam Box Hummus Chips

EAT REAL Hummus Chips Meersalz

 

Leichter salziger Snack für einen gemütlichen Fernsehabend! Die Chips sind schön knusprig und nicht zu sehr gesalzen, wodurch man keinen Heißhunger bekommt!

  • Inhalt: 135g
  • hoher Ballaststoffgehalt
  • ohne Konservierungsstoffe
  • vegan

Zutaten: Kichererbsenmehl (45%), Reis, Kartoffelstärke, Pflanzenöl (Rapsöl), Maismehl, Meersalz

Jetzt online stöbern: 

Foodist Hummus Chips (2,80 Euro)

➤ Auch bei Amazon: Eat Real Hummus Chips (2,99 Euro)

 

Everdrop Spülmaschinen Tabs Pam Box
Everdrop Spülmaschinen Tabs Pam Box

EVERDROP Spülmaschinentabs

 

Umweltfreundliche Spülmaschinentabs ohne Mikroplastik und in kompostierbarer Verpackung. Die Tabs duften schon aus der Verpackug heraus sehr intensiv, deshalb besser abseits von Lebensmitteln lagern!

  • Inhalt: 20 Tabs
  • hohe Spülkraft
  • biologisch abbaubar
  • duftet nach Limone, Minze und Ingwer

Jetzt online stöbern:

Foodist Everdrop Spülmaschinentabs (11,50 Euro)

Amazon Everdrop Putzmitteltabs (14,99 Euro)

Pam Box April 2021
Pam Box April 2021
Pam Box April 2021

Meine Meinung zur Pam Box April 2021 – lohnt sie sich?

Ich finde den Inhalt der Pam-Box April 2021 ganz in Ordnung. Die Box ist sehr ausgeglichen zusammengestellt mit süßen und salzigen Snacks, Koch-Produkten (die Nudeln) und einem Reinigungsprodukt. Es ist somit für jeden was dabei.

Die Everdrop-Spülmaschinentabs finde ich super, um nachhaltige Reinigungsmittel auszuprobieren und etwas Gutes für die Umwelt zu tun. Die Chips sind sehr lecker, nicht zu salzig und waren auch schnell aufgefuttert 🙂 

Für meinen Geschmack hätte ich mir jedoch etwas mehr würzige/unsüße Snacks gewünscht, weil man um Ostern rum meist sowieso mehr Schoki isst als sonst und da waren das Kakao-Topping, der Kakao-Ball und der Karamell Riegel irgendwie etwas zu viel nach der ganzen Schlemmerei der letzten Tage. Obwohl ich beim 100%-igen Rohkakao-Topping zugebe, dass dieses mehr bitter als süß ist (aber bitte ist ja bekanntlich sehr gesund!). 

Bin schon gespannt auf die nächste Pam Box, die im Juni kommt! 🙂 

Diese Beiträge könnten dich auch interessieren:

Inhalt Pam Box Oktober 2020

Inhalt Pam Box Dezember 2020

Inhalt Pam Box Februar 2021

Il Makiage Foundation – Inhaltsstoffe und Bewertung der Woke Up like this Foundation

Il Makiage Foundation – Inhaltsstoffe und Bewertung der Woke Up like this Foundation

Il Makiage ist eine 2018 gegründete Beauty-Marke und hat sich auf Make-Up spezialisiert. Im November 2020 launchte Il Makiage erstmals in Deutschland. Und ich weiß nicht wie es bei dir war, aber ich wurde bei Instagram mit Werbung für Il Makiage förmlich überschwemmt – bis ich so neugierig geworden bin, dass ich das Make-Up unbedingt ausprobieren wollte. Die Werbeversprechen klangen fast schon unrealistisch gut – ich wollte herausfinden, ob die Produkte von Il Makiage wirklich so gut sind.

Die Idee von Il Makiage basiert darauf, dass man mithilfe eines Quiz eine perfekt auf den Hautton abgestimmte Foundation finden und dann online bestellen kann.

Die Produkte von Il Makiage sind ausschließlich online erhältlich. Zu den Bestsellern gehört unter dem anderen die „Woke Up like this“-Foundation für 46 Euro. Mit mehr als 150.000 Bewertungen zählt die Foundation sogar zu den am meisten bewerteten Beauty-Produkten in den USA!

Der Erfolg von Il Makiage liegt unter anderem in dem neuartigen Algorithmus, an welchem zwei Jahre lang gearbeitet wurde. Mit diesem Algorithmus wird das Online-Shopping erheblich vereinfacht, da die perfekte Nuance der Foundation in nur 90 Sekunden ermittelt werden kann. Ganz ohne Hochladen von Fotos oder Ausprobieren der Foundation auf der Haut.

 

➤ Hier gelangst du zum Beitrag Erfahrung und Testbericht über Il Makiage 

 

Il Makiage
Il makiage

Wie gut ist die Foundation von Il Makiage wirklich?

 

In meinem Erfahrungsbericht zur „Woke Up Like This“-Foundation von Il Makiage habe ich bereits darüber berichtet, wie das berühmte Beauty-Quiz funktioniert und ob ich damit die perfekte Foundation für mich finde konnte (kleiner Spoiler: die Antwort ist nicht ganz so einfach).

Da die Produkte von Il Makiage nun sehr beliebt sind und vermehrt beworben werden, habe ich mir die Foundation nochmal genauer angeschaut, um herauszufinden, wie gut sie wirklich ist. Gut im Sinne von ihrer gesundheitlichen Wirkung auf die Haut.

Dass Il Makiage keine Naturkosmetik-Marke ist, ist ja klar. Und trotzdem möchte ich herausfinden, ob die Inhaltsstoffe eine gesunde und schöne Haut unterstützen, oder ob die Foundation eher schädlich für die Haut ist.

 

Il Makiage Inhaltsstoffe

 

Kommen wir zuerst zu den Inhaltsstoffen. Diese sind auf der Website von Il Makiage sehr transparent aufgeführt:

Aqua/Wasser, Cyclopentasiloxan, Dimethicon, Isododecan, Talkum, PEG-10 Dimethicon, Ethylen/Acrylsäure-Copolymerisat, Octocrylen, denaturierter Alkohol, PEG-4, Isononylisononanoat, Caprylyl Dimethicon Ethoxy Glucosid, Polymethylmethacrylat, Myristyllaktat, Polysorbat 20, Natriumchlorid, Disteardimoniumhektorit, Cetyl-Dimethicon, Dimethicon/Vinyl-Dimethicon-Kreuzpolymer, Benzylalkohol, Natriumdehydroacetat, Wasserstoff-Dimethicon, Kieselsäure, Magnesium-Aluminium-Silikat, Tocopherylacetat, Triethoxycaprylylsilan, Aluminiumhydroxid, Polymethylsilsesquioxan, Dinatrium-Edta, Biosaccharid Gum-4, Natriumhyaluronat, Phenoxyethanol, Parfum / Duftstoff, Titandioxid.
ENTHÄLT MÖGLICHERWEISE: Ci 77891 (Titandioxid), Ci 77492 (Eisenoxide), Ci 77491 (Eisenoxide), F Ci 77499 (Eisenoxide), T-Butylalkohol, Alkohol.

Auf den ersten Blick sind das ganz schön viele Inhaltsstoffe, die zu dem sehr chemisch klingen. Was sich wohl dahinter verbirgt?

Ich gehe die Inhaltsstoffe nun nach der Reihe durch und schaue, was dahintersteckt und wie die einzelnen Stoffe auf die Haut wirken.

InhaltsstoffWirkungKomedogenitätProblematikEinstufung
Wasser
  • Sorgt für flüssige Konsistenz
nicht komedogenkeineempfehlenswert
Cyclopentasiloxan (Silikon)
  • Glättender, weich machender Effekt
sehr stark komedogen
  • Nur pseudo-pflegend, legt sich wie eine Folie über die Haut.
  • Verdacht auf krebserregende Eigenschaften, jedoch wissenschaftlich nicht bestätigt.
bedenklich
Dimethicon (Silikon)
  • Steigert die Hautelastizität
  • Sorgt für ein angenehmes Hautgefühl
  • Feuchtigkeitsspendend
sehr stark komedogen
  • versiegelnder Effekt, da Silikon
  • auf Mineralölbasis, schädlich für die Umwelt
leicht bedenklich
Isododecan (Lösenmittel) 
  • glättender und geschmeidig machender Effekt
  • verleiht ein schwerloses Tragegefühl
leicht komedogen
  • auf Mineralölbasis, daher schädlich für die Umwelt
  • möglicherweise toxisch oder gesundheitsschädlich, Untersuchung ausstehend
bedenklich

 

Il Makiage Woke up like this Foundation
Il Makiage Woke up like this Foundation

 

InhaltsstoffWirkungKomedogenitätProblematikEinstufung
Talkum (Mineral aus Magnesiumsilikat)
  • bindet Wasser
  • wirkt schützend auf die Haut
  • oft in Babypuder enthalten
  • beim Einatmen größerer Mengen eingeatmet  (z.B. bei Babypuder) besteht Gefahr für die Lunge
  • Risiko einer möglicherweise krebserregenden Wirkung bislang ungeklärt
leicht bedenklich
PEG-10 Dimethicon (Emulgator)
  • umhüllt die Haut wie mit einem Schutzfilm
  • sorgt für ein weiches und geschmeidiges Hautgefühl
sehr stark komedogen
  • Bei bestimmten Hauttypen kann der versiegelnde Effekt zu Hautproblemen führen
  • kann die Barrierefunktion der Haut schwächen
bedenklich
Ethylen/Acrylsäure-Copolymerisat
  • erzeugt eine Art Schutzfilm auf der Haut
  • macht Produkte wisch- und wasserfest
leicht komedogen
  • schädlich für die Umwelt, da es sich um einen Kunststoff handelt
  • versiegelnder Effekt kann bei best. Hauttypen zu Hautproblemen führen
leicht bedenklich
Octocrylen (UV-Schutz)
  • schützt die Haut vor lichtbedingter Alterung und Hautkrebs
  • steht im Verdacht, schädlich für Gesundheit und Umwelt zu sein
  • u.a. soll es Allergien auslösen und hormonell wirken (Fortpflanzungsfähigkeit beeinträchtigen), wissenschaftlich jedoch nicht belegt
Denaturierter Alkohol
  • antimikrobiell
  • parfümierend
  • kann zu Hautreizungen führen
  • ist als Inhaltsstoff in Kosmetika umstritten
Il makiage
InhaltsstoffWirkungKomedogenitätProblematikEinstufung
PEG-4
  • Weichmacher
  • Konsistenzgeber
  • kann die Barrierefunktion der Haut schädigen
bedenklich
Isononylisononanoat
  • Weichmacher
  • sorgt für  gleichmäßige und glatte Foundation
  • bewahrt die Feuchtigkeit der Haut
empfehlenswert
Caprylyl Dimethicon Ethoxy Glucosid (Silikon)
  • sorgt für eine glatte Hautoberfläche
stark komedogen
  • legt sich wie alle Silikone wie eine Folie auf die Haut, kann dadurch Hautprobleme begünstigen
leicht bedenklich
Polymethylmethacrylat (Kunststoff)
  • Weichzeichner/ Soft-Fokus-Effekt
  • Produkt lässt sich leicht auf der Haut verteilen
  • umweltschädlich, da Mikroplastik
bedenklich
Myristyllaktat (Emulgator)
  • macht die Haut glatt und geschmeidig
stark komedogen
  • kann die Poren verstopfen und Unreinheiten begünstigen
Polysorbat 20 (Emulgator)
  • sorgt dafür, dass Öl und Wasser sich verbinden
  • kann Barrierfunktion der Haut schwächen
leicht bedenklich
Natriumchlorid (Kochsalz)
  •  sorgt für eine cremige Konsistenz
sehr stark komedogen
  • kann bei sensibler Haut Irritationen hervorrufen
empfehlenswert

 

InhaltsstoffWirkungKomedogenitätProblematikEinstufung
Disteardimoniumhektorit
  • verbessert Stabilität und Haltbarkeit von Inhaltsstoffen oder Formulierungen
  • erhöht/verringert die Viskosität von Kosmetika
empfehlenswert
Cetyl-Dimethicon
  • umhüllt Haut mit einem Schutzfilm, der die Haut glatter und feiner erscheinen lässt
sehr stark
  • kann Poren verstopfen
  • versiegelnder Effekt kann bei bestimmten Hauttypen zu Hautproblemen führen
leicht bedenklich
Dimethicon/Vinyl-Dimethicon-Kreuzpolymer
  • lässt Haut weicher erscheinen
  • legt sich wie Schutzschild über die Haut, glättet oberflächlich die Haut
sehr stark
  • Kunststoff, damit schädlich für die Umwelt
  • versiegelnder Effekt kann zu Hautproblemen führen
  • kann Poren verstopfen
leicht bedenklich
Benzylalkohol
  • desinfizierend
  • sorgt dafür, dass Kosmetika länger haltbar sind
  • kann leicht hautreizend wirken
  • Vorsicht bei einer Kontaktallergie gegen Benzylalkohol
empfehlenswert
Natriumdehydroacetat (Konservierungsmittel)
  • schützt kosmetische Produkte vor dem mikrobiellen Verderb
empfehlenswert
Wasserstoff-Dimethicon
  • bildet einen glatten Film über der Haut
sehr stark komedogen
  • der versiegelnde Effekt kann zu andauernden Hautproblemen führen
leicht bedenklich
Il makiage
Il Makiage
InhaltsstoffWirkungKomedogenitätProblematikEinstufung
Kieselsäure
  • weichzeichnend
  • absorbierend
empfehlenswert
Magnesium-Aluminium-Silikat
  • weichzeichnend
  • absorbierend
empfehlenswert
Tocopherylacetat (Antioxidant)
  • zellschützend und -erneuernd
  • antioxidativ
  • feuchtigkeitsspendend
empfehlenswert
Triethoxycaprylylsilan sehr stark
  • silikonbasiert, kann zu verstopften Poren und Hautproblemen führen
leicht bedenklich
Aluminiumhydroxid
  • enthält Aluminium, kann die Haut irritierend
  • Zusammenhang mit Brustkrebs und Alzheimer ist ungeklärt
leicht bedenklich
Polymethylsilsesquioxan
  • Pflegesubstanz
sehr stark komedogen
  • versiegelnder Effekt kann zu Hautproblemen führen
leicht bedenklich
Dinatrium-Edta
  • verstärkt die Wirkung von Konservierungsmitteln
leicht komedogen
  • umweltbelastend
  • kann Hautreizungen und Allergien auslösen
  • kann Hautbarriere angreifen
bedenklich
InhaltsstoffWirkungKomedogenitätProblematikEinstufung
Biosaccharid Gum-4 
  • Verdickungsmittel
empfehlenswert
Natriumhyaluronat (Hyaluronsäure)
  • feuchtigkeitsspendend
  • polstert die Haut auf
  • verbessert die Hautelastizität
  • zellerneuernd
  • hautstraffend
nicht komedogenempfehlenswert
Phenoxyethanol (Konservierungsmittel)
  • wirkt antimikrobiell
leicht komedogen
  • kann die Haut reizen und Allergien auslösen
  • kann die Hautbarriere angreifen
bedenklich
Parfum / Duftstoff
  • sorgt für angenehmen Duft

 

  • je nach Parfum hohes Allergiepotenzial
Titandioxid (UV-Filter)
  • antimikrobiell
  • schützt vor UV-Strahlen
  • entzündungshemmend
  • sorgt für Leuchtkraft und Farbintensität
  • ermöglicht die Herstellung vieler Farbnuancen
  • nimmt überschüssiges Fett auf und reduziert Glanz

empfehlenswert

 

* Die Informationen in diesem Beitrag stammen von eattraincare.de, kosmetik.org, lesielle.com, hautschutzengel.de, utopia.de

 

 

Glamour Shopping Week 2021 – spare bei diesen nachhaltigen Shops!

Glamour Shopping Week 2021 – spare bei diesen nachhaltigen Shops!

Die Glamour Shopping Week 2021 steht an – und damit die Möglichkeit, bei vielen tollen Shops Rabattaktionen zu nutzen und günstig zu shoppen! Vom 01.04.2021 bis zum 11.04.2021 kannst du bei über 140 teilnehmenden Partnern bis zu 40 Prozent sparen und dir Geschenke und Vorteile sichern. Weitere Informationen über die Glamour Shopping Week 2021 findest du hier!

In diesem Beitrag verschaffe ich dir einen Überblick über die besten Deals von teilnehmenden nachhaltigen und umweltbewussten Shops der Glamour Shopping Week.

1. etepetete

 

Etepetete ist ein Bio-Onlineshop, welcher biologische Produkte, welche nicht der Norm entsprechen, vor dem Wegwerfen rettet. So kannst du dir verschiedene Boxen bestellen, welche voll gefüllt sind mit Lebensmitteln wie krummen Gurken, mehrbeinigen Karotten oder Bruchschokolade. Die Boxen werden wöchentlich bzw. alle zwei Wochen, je nach Wahl, geliefert.

Etepetete bietet mehrere Boxen zur Auswahl an, beispielsweise:

  • die „Gemüse Box Classic Family“
    • Inhalt: verschiedenes Gemüse direkt vom Feld, wie Aubergine, Kartoffeln oder Möhren. 
  • die „Basic Box“
    • Inhalt: Bio-Grundnahrungsmittel wie Nudeln, Reis, Suppen, Saucen und Konserven.
  • die „Retter Snack Box“
    • Inhalt: Bio-Snacks wie Crunchy Müsli, Reiswaffeln oder Kokos Chips.

Auf der Website von etepetete wird bei jeder Box explizit erklärt, welchen genauen „Mangel“ die Lebensmittel haben, was ich total super und transparent finde!

Glamour Shopping Week Deal: Im Bio-Onlineshop etepetete erhältst du in der Glamour Shopping Week 9 Euro Rabatt auf die Bestellung deiner Wunschbox!

▶ jetzt im Shop stöbern: etepetete-bio.de

2. Junglück

 

Junglück ist ein nachhaltiges Kosmetikunternehmen aus München, welches vegane und natürliche Pflegeprodukte für Haut, Haare und Körper herstellt. Junglück verzichtet auf zusätzliche Inhaltsstoffe wie Duftstoffe, Mineralöl, Parabene, Füllstoffe und Silikone. Dadurch sind die Produkte besonders gut verträglich und nachhaltig. 

Zu den beliebstesten Produkten von Junglück zählen:

  • das Vitamin C Serum (klicke hier, um direkt zum Produkt zu gelangen)
  • Rosenwasser (klicke hier, um direkt zum Produkt zu gelangen)
  • Aloe-Vera-Gel (klicke hier, um direkt zum Produkt zu gelangen)
  • Hyaluron Tages- und Nachtcreme(klicke hier, um direkt zum Produkt zu gelangen)
  • und das Retinol-Serum (klicke hier, um direkt zum Produkt zu gelangen).

Glamour Shopping Week Deal: Spare 15% auf das gesamte Produktsortiment von Junglück!

▶ Jetzt im Shop stöbern: Junglueck.de 

P.S.: Auch ich bin seit Längerem Fan von Junglück und benutze täglich die Hyaluron-Tagescreme, das Vitamin C Serum, die Hyaluron-Nachtcreme sowie das Rizinus Öl. Bin sehr zufrieden! 🙂

P.P.S.: Hier habe ich über den Junglück Adventskalender 2020 berichtet. Schau gerne vorbei!

3. HEJ Natural

 

Im Online-Shop von HEJ Natural findest du gesunde und mega leckere Snacks und Proteinshakes mit extra wenig Zucker. Die Produkte sind perfekt für alle, die gerne gesund naschen und gleichzeitig nicht auf tollen Geschmack verzichten wollen!

Entdecke online die beliebtesten Produkte von HEJ Natural:

Glamour Shopping Week Deal:  20 % Rabatt auf alles und kostenfreier Versand ab 20 €!

▶ Jetzt im Shop stöbern: hej-natural.de

4. MyMuesli

 

MyMuesli ist bekannt und beliebt für die riesige Auswahl an Müslis: egal ob Schoko-Müsli, Früchte-Müsli, Bircher-Müsli oder Nuss-Müsli – bei MyMuesli wird jeder Müsli-Fan fündig! Neu ist bei MyMuesli das vegane Müsli, unter anderem in der Sorte Raspberry Dark Choc. Lecker!

Das kann MyMuesli außerdem:

  • MyMuesli 2GO: Die praktischen Portionsbecher kannst du überall mit hinnehmen und sofort genießen!
  • Porridge in Bio-Qualität
  • Bio Smoothie Bowls, u.a. in der Geschmacksrichtung Banana Choc und Berry
  • Snacks wie Müsliriegel, Nut Butter Balls und Toppings
  • Zubehör, zum Beispiel Thermo 2GO Becher, Müsli TO GO Becher, Fruit Pots und Overnight Oats Glas

Tipp: Mit dem „Mixer“ kannst du dir aus 80 Bio-Zutaten dein Wunsch-Müsli oder Porridge zusammenstellen!

Glamour Shopping Week Deal: Ab 15 € erhältst du ein GLAMOUR-Müsli im Wert von 7,90 € geschenkt dazu!

Und es gibt sogar einen zweiten Deal: Ab 20 € erhältst du eine „Nut Butter Balls“-Trio-Box – neun leckere Balls mit Mandel-, Haselnuss- oder Erdnussmus – im Wert von 8,90 €.

▶ Jetzt im Shop stöbern: mymuesli.com

5. Naughty Nuts

 

Naughty Nuts ist bekannt für biologisches Nussmuß in leckeren, außergewönlichen Sorten. Das Nussmuß besteht aus 100% biologischen Zutaten ohne Palmöl und ohne zusätzlichen Zucker. Des Weiteren sind die Produkte vegan

Unter anderem gibt es diese leckeren Sorten bei Naughty Nuts:

  • Mandelmuß Blueberry Bash
  • Erdnussmuß Cacao Crunsh
  • Mandelmuß Smooth.

Glamour Shopping Week Deal: 20% Rabatt auf alles!

 

▶ Jetzt im Shop stöbern: naughtynuts.de

6. das boep

 

Im Naturkosmetik Shop das boep dreht sich alles um Sonnenschutz, Babypflege und Mamapflege. Alle Produkte sind zertifiziert, vegan und eignen sich optimal für sensible Haut

Des Weiteren sind die Produkte von das boep frei von:

  • Mineralölen
  • synthetischen Duftstoffen
  • Parabenen. 

Produkte von das boep findest du im Onlineshop, bei Amazon oder in dm Shops. 

 

Glamour Shopping Week Deal: 20% Rabatt auf alles!

 

▶ Jetzt im Shop stöbern: dasboep.de 

7. Motel a Miio

 

Bei Motel a Miio erhältst du exklusive Keramik aus Portugal. Die handgefertigten Stücke werden fair und umweltbewusst produziert sowie handverlesen ausgesucht und bemalt. Echte Einzelstücke für ein Stück mediterrane Leichtigkeit im eigenen Zuhause.

Bei Motel a Miio findest du unter anderem:

  • Tableware (Tassen, Teller, Servierplatten, Geschirrsets)
  • Accesoires (Seifenschalen, Dosen, Vasen, Karafffen, etc.)

Glamour Shopping Week Deal: 30% Rabatt auf alles!

 

▶ Jetzt im Shop stöbern: motelamiio.com

8. WoolOvers

 

Bei dem britischen Label WoolOvers erhältst du  feinste Strickware aus Kaschmir, Wolle und Baumwolle

Dafür steht WoolOvers:

  • die Verwendung von natürlichen, biologisch abbaubaren Garnen
  • farbenfrohe und gemütliche Kleidung 
  • keine Kunststoff Garne wie Acryl und Polyester
  • 100% britischer Stil.

Glamour Shopping Week Deal: ab 30 € gibt es 20% Rabatt auf alles sowie kostenlose Lieferung!

 

▶ Jetzt im Shop stöbern: woolovers.de

Nachhaltige Mode
Nachhaltige Mode

9. VOGUE Collection

Bei VOGUE Collection erhältst du exklusiv & fair produzierte Classic- & Capsule Collections. Die Produkte aus umweltschonenden und nachhaltigen Ressourcen hergestellt. Ziel von VOGUE Collections ist es, den ökologischen Fußabdruck zu minimieren und die Wertschöpfungskette nachhaltig zu gestalten. 

erantwortung
rganisch
G reen
mweltfreundlich
xklusiv

Der Glamour Shopping Week Deal: erhalte 20% Rabatt auf ausgewählte Produkte!

 

▶ Jetzt im Shop stöbern: shop.vogue.de

10. The Female Company

 

Bei dem Start-Up aus Berlin erhältst du Perioden- und Wochenbettprodukte aus zertifizierter Bio-Baumwolle, beispielsweise Bio-Tampons in kompostierbarer Folie und Menstruationstassen. Alle Produkte werden ohne Chemie und Pestizide angebaut und sind damit besonders umweltschonend und nachhaltig. 

Das Besondere: Mit jedem Boxkauf unterstützt Du eine Frau in Indien mit Periodenprodukten, die sie sich sonst nicht leisten könnte. So kannst du gleichzeitig etwas Gutes für Dich selbst und für andere Frauen tun!

Glamour Shopping Week Deal: Ab 14 € gibt es 20% Rabatt auf alles!

 

▶ Jetzt im Shop stöbern: thefemalecompany.com

11.  Boden

 

Bei dem britischen Modelabel Boden erhältst du klassische Styles in hochwertiger Qualität für Männer, Frauen und Kinder.

Der Grundsatz von Boden ist es, langlebige Mode zu schaffen, die mehrere Generationen lang getragen werden kann. Deshalb gibt es als kleinen Clou in jedem Mini Mantel ein Namensschildchen, wo du deinen Namen eintragen kannst.

Glamour Shopping Week Deal: 20 % Rabatt + kostenlose Lieferung+ eine stylishe Pouch als Geschenk!

▶ Jetzt im Shop stöbern: bodendirect.de