Seite wählen
For Your Soul Box September 2021 – Inhalt der Foodbox von Stefanie Giesinger & Foodist

For Your Soul Box September 2021 – Inhalt der Foodbox von Stefanie Giesinger & Foodist

Foodist hat in Zusammenarbeit mit Model und Influencerin Stefanie Giesinger eine neue Foodbox herausgebracht mit dem schönen Namen „For your soul“-Box. Getreu dem Motto, sich ab und zu etwas Gutes zu tun und auf sich selbst zu achten, enthält die Box vegane, umweltfreundliche und leckere Produkte , auf die man sich regelmäßig freuen kann.

Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Konzept und Inhalt der For Your Soul-Box

In jeder For Your Soul-Box sind 6 bis 8 Produkte enthalten, darunter vegane Snacks und Kochprodukte, ein nachhaltiges Zubehör und eine Grußkarte. Die For Your Soul- Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Das Besondere: Pro Box wird 1€ an den Verein „Freunde fürs Leben“ gespendet, welcher Tabu-Themen wie Depressionen sichtbar macht und die Wichtigkeit von mentaler Gesundheit fokussiert.

For your soul box

Was kostet die For Your Soul-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung. Als kleines Extra ist die erste Box kostenfrei!

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung. Bonus: Ein 50€ Foodist-Gutschein!

 

Geheimtipp: Die For Your Soul-Box kannst du verschenken, indem du einfach die Adresse änderst!  So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. 

Wie häufig wird die For Your Soul-Box geliefert?

Die For Your Soul-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

For your soul box
For your soul box

Inhalt der For Your Soul-Box September 2021

Die For Your Soul-Box von September 2021 enthält folgende 8 Produkte (wenn du auf den Link klickst, kommst du zu dem Produkte bei Foodist):

Der Gesamtwert der Box liegt bei 40,78 Euro. Mit dem 12-Monats-Abo spart man somit sogar 11 Euro plus Versandkosten (im Vergleich dazu, wenn man sich die Produkte einfach so bei Foodist bestellen würde). 

UP2U Faltbarer Mehrwegbecher „Stone“

For your Soul Box 2021
For your Soul Box 2021

♥ Faltbarer Mehrwegbecher ♥ umweltfreundlich und platzsparend ♥  Fassungsvermögen 350 ml ♥ perfekt für unterwegs

Dieser faltbare Mehrwegbecher ist sehr praktisch für unterwegs und lässt sich platzsparend zusammenfalten. Durch einen festen Gummi wird der Becher klein gehalten, die Öffnung zum Trinken kann geschlossen werden. Bis auf die eher langweilige Farbe ein sehr tolles Produkt!

OHSO LECKER Honig-Senf Sauce

OHSO LECKER Honig-Senf Sauce

♥ Vegane Sauce zum Dippen, Tunken und Verfeinern ♥ zuckerreduziert ♥ fettarm ♥ gluten- und laktosefrei

Diese Honig-Senf-Sauce schmeckt würzig und sehr harmonisch – süß, sauer und ein kleines bisschen scharf. Besonders lecker finde ich die Sauce zu Süßkartoffelpommes oder als Sauce auf einem selbstgemachten Burger!

HEMI BIO Hanfsamendrink zuckerfrei

HEMI BIO Hanfsamendrink zuckerfrei

♥ vegan ♥ ohne Konservierungsstoffe ♥ umweltfreundlicher Hanf-Drink

Veganer Milchersatz ist nicht neu – Hanfsamenmilch aber schon. Da Hanfprodukte gerade sowieso boomen keine Überraschung, dass es neben Soja-, Mandel und Hafermilch nun auch Hanfsamenmilch gibt. Hanfsamen gelten als Superfood und die Milch schmeckt leicht nussig und sehr angenehm im Müsli oder Porridge. 

CHILLCHOC BIO Schokoladenpulver mit Hanf „Original“

CHILLCHOC BIO Schokoladenpulver mit Hanf "Original"

♥ Kakao-Pulver mit Hanfextrakt ♥ mit gemahlenem Hanfblattpulver ♥ ohne Konservierungsstoffe ♥ vegan

Passend zur Hanfsamenmilch gibt es zusätzlich ein lösliches Kakopulver mit Hanfblattpulver und gemahlenen Lindenblüten. Das CBD wirkt dabei beruhigend und entspannend. Nicht zu süß und ausschließlich aus natürlichen Zutaten hergestellt.

LYCKA BIO Granola Himbeere Erdbeere

LYCKA BIO Granola Himbeere Erdbeere

♥ biologisches Granola ♥ schonend gebacken ♥ mit Vollkornhaferflocken ♥ vegan

Dieses biologische Granola schmeckt nicht nur gut, sondern man kann damit auch Gutes tun – das sozial engagierte Unternehmen investiert einen Teil des Gewinns in Schulspeisungen in Afrika!

RAW BITE BIO Rohkostriegel Apple Cinnamon

RAW BITE BIO Rohkostriegel Apple Cinnamon

♥ Raw Bite Riegel aus Früchten und Nüssen ♥ gluten- und laktosefrei ♥ ohne Konservierungsstoffe ♥ mit natürlicher Süße ♥ biologisch

Dieser Raw Bite Riegel basiert auf Früchten und Nüssen und schmeckt lecker nach einem zimtigen Apfelstrudel. Perfekt als Snack für Zwischendurch!

SAVOURSMITHS Chips mit Trüffel und Rosmarin

SAVOURSMITHS Chips mit Trüffel und Rosmarin

♥ Chips mit Trüffeln und Rosmarin ♥ gluten- und laktosefrei ♥ ohne Konservierungsstoffe ♥ vegan

Chips mit Trüffeln habe ich vorher noch nie probiert und bin positiv überrascht. Der Geschmack ist sehr würzig und pikant und wirklich außergewöhnlich. Perfekt zum Knuspern mit einem Glas Wein auf der Couch 🙂 

For your Soul Box

Fazit zur For your Soul-Box September 2021

 

Der Inhalt dieser For your Soul-Box von September 2021 ist allein vom Preis her unschlagbar, da man 11 Euro spart im Gegenzug dazu, wenn man die Produkte einzeln bei Foodist kaufen würde. Es sind mit den Hanfsamen-Produkten neuartige Produkte dabei die gerade boomen und ich war deshalb sehr neugierig, diese zu probieren. Den Faltbecher kann man super für unterwegs mitnehmen und er hält gut dicht, was mir persönlich bei einem Becher to go sehr wichtig ist. 

Insgesamt finde ich den Inhalt der September Box vielfältig und gut ausgewählt und hab die Hälfte auch schon aufgegessen – und freue mich auf die nächste Box!

Keratin-Glättung xpress von Kativa: meine Erfahrung mit der dauerhaften Keratin-Behandlung für zuhause

Keratin-Glättung xpress von Kativa: meine Erfahrung mit der dauerhaften Keratin-Behandlung für zuhause

Um krause, frizzige Haare zu bändigen und dauerhaft zu glätten, gibt es eine tolle Methode, die mithilfe von dem haareigenen Baustein Keratin die obere Schuppenschicht der Haare verschließt und damit seidiges, aalglattes Haar zaubert. Bekannt ist die Methode unter verschiedenen Namen: Keratin Glättung, Brazilian Blowout oder auch Brasilianische Haarglättung. Einmal durchgeführt, kann die Keratinglättung von 3 bis zu 6 Monaten halten. Die Bezeichnung „dauerhaft“ ist daher etwas irreführend – für immer hält die Behandlung nicht.

Das Beste an der Keratin Glättung ist, dass diese selbst die wildesten Haare bändigen kann (sogar Afrolocken!), und damit für alle Haartypen geeignet ist.

Da ich selbst sehr frizzige und „buschige“ Haare habe, habe ich schon mehrere Keratin-Behandlungen ausprobiert – von für 450 Euro beim Friseur oder für 15 Euro von Rossmann war wirklich alles dabei.

In diesem Artikel möchte ich über meine Erfahrungen mit der xpress Keratin-Glättung von Kativa berichten.

 

Glatte Haare mit der Keratin Behandlung

Wie funktioniert eigentlich eine Keratin-Behandlung? Eigentlich ist das Prinzip ganz einfach: Das Protein Keratin ist der Hauptbestandteil von unseren Haaren. Bei einer Keratin-Behandlung wird Keratin in Form einer Creme auf das Haar aufgetragen, dringt in die Schuppenschicht ein und umhüllt die Haare. Beim anschließenden Föhnen und Glätten wird das Keratin in die Schuppenschicht der Haare eingeschleust und die sogenannten Disulfid-Brücken richten sich neu aus. Das führt dazu, dass die gesamte Haarstruktur geglättet wird und die Haare dauerhaft glatt bleiben. 

Keratin-Behandlungen werden in Friseursalons angeboten (am besten vorher nachfragen oder auf der Website nachgucken, weil dies noch nicht alle Friseure anbieten) oder können auch im Set für zuhause erworben werden, beispielsweise auf Amazon oder in der Drogerie. Die Kosten sind hierbei sehr unterschiedlich: Während man beim Friseur für eine Keratin-Glättung zwischen 230 und 500 Euro zahlt, gibt es Keratin-Glättungen für zuhause schon ab 15 Euro in der Drogerie.

 

Wichtige Facts zur Keratin-Glättung

  • Die Haare werden dauerhaft geglättet für 3-6 Monate

  • Die Haare sind glänzender und geschmeidiger, haben aber auch weniger Volumen.

  • Eine Keratin Glättung eignet sich für jeden Haartyp, insbesondere aber für lockige und krause Haare.

  • Nach der Glättung dürfen die Haare 48 Stunden nicht gewaschen  werden.

  • Die Keratin Glättung dauert je nach Haarlänge und Haarvolumen etwa zwei bis vier Stunden.

  • Kosten beim Friseur: zwischen 200 und 500 Euro je nach Haarlänge (beim Friseur).

  • Kann auch auf gefärbten oder getönten Haaren angewendet werden.  

Eine Keratin-Behandlung ist zwar teuer, spart aber viel Zeit und aufwändiges Styling! Die Haare liegen nach dem Waschen sofort glatt und sind seidig und glänzend. Wenn man dann doch Locken oder Wellen machen möchte, geht das wesentlich schneller und die Locken halten länger.

 

Unterschied zwischen Brazilian Blowout und Keratin Glättung

 

Ein Brazilian Blowout hat den gleichen glättenden Effekt wie eine Keratin Behandlung und dient auch zur Eliminierung von Frizz und zur dauerhaften Glättung der Haarstruktur. Beim Brazilian Blowout kann der Friseur jedoch durch eine spezielle Anwendung mit dme Glätteisen eine natürliche Haarstruktur beibehalten, sodass die Haare nicht wie bei einer Keratin-Behandlung komplett aalglatt sind. 

Vor einigen Jahren ist das Brazilian Blowout in Verruf geraten, da bei der Anwendung Formaldehyd und andere gesundheitsschädliche Stoffe freigesetzt wurden, die zu Reizungen der Atemwege und Augen führen können. Inzwischen wurden formaldehyd-freie, schonendere Treatments entwickelt, trotzdem sollte man vorher gezielt im Salon nachfragen.  

Keratin Glättung glatte Haare

Risiken bei einer Keratin-Glättung

 

Grundsätzlich ist eine Keratin-Glättung, soweit formaldehyd-frei, unbedenklich und nicht gesundheitsschädlich. Bei strapazierten und sehr kaputten Haaren ist trotzdem Vorsicht geboten: Durch das Arbeiten mit dem Glätteisen und entsprechend hoher Temperatur können die Haare nämlich noch zusätzlich geschädigt werden. 

Des Weiteren entsteht bei der Einarbeitung des Keratin-Treatments mit dem Glätteisen in die Haare Dampf, der die Augen und Atemwege reizen kann. Wer besonders empfindlich ist, sollte deshalb besser eine Maske tragen oder die Augen schließen.

Da bei einigen Produkten Formaldehyd freigesetzt wird, welches als krebserregend eingestuft wird, ist es wichtig sich vorher über das Produkt zu informieren. Das Formaldehyd in Keratin-Cremes dient  als Lösungsmittel, durch das die Schwefelverbindungen in dem natürlichen Keratinpanzer im Haar gelöst werden. Bei der anschließenden Glättung werden diese unter Hitzeeinwirkung erneut mit dem Keratin aus dem Produkt verschmolzen. Dabei entsteht der Glättungseffekt.

Die Gefahr bei der Verwendung von Produkten mit Formaldehyd liegt in den Dämpfen, die während der Hitzeeinwirkung beim Glätten entstehen, und von Kunden und Friseuren eingeatmet werden.

 

So funktioniert die Keratin-Glättung

 

In diesen 5 Schritten läuft die Keratin-Behandlung ab:

1. Zunächst werden die Haare mit einem speziellen Shampoo gewaschen und von Restbeständen von Pflegeprodukten befreit.

2. Danach wird die Keratin-Tinktur partieweise auf die noch feuchten Haare aufgetragen und gründlich eingearbeitet. Bei manchen Friseuren werden die Haare vor dem Auftragen zu 70% trocken geföhnt. 

3. Nach einer zirka 10-20 minütigen Einwirkzeit werden die Haare trocken geföhnt.

4. Anschließend werden die Haare Strähne für Strähne mit dem Glätteisen auf höchster Stufe geglättet.

5. Danach werden die Haare gewaschen, mit einer Haarkur gepflegt und erneut trocken geföhnt.  

Je nach Haarlänge kann die Anwendung zwischen 2 und 4 Stunden dauern. Bei manchen Salons sind gleich zwei Friseure gleichzeitig am Werk, damit das Treatment schneller geht.

Meine Erfahrung mit der Keratin-Glättung beim Friseur

 

Ich habe bisher meine Haare vier Mal mit einer Keratin-Behandlung glätten lassen. Dabei hat es mal mehr, mal weniger gut geklappt. 

Mein erste Keratin-Glättung habe ich bei einem Friseur gemacht, welcher Produkte von der Marke Newsha benutzt hat. Auf der Website von Newsha wird unter anderem dafür geworben, dass die Produkte die Haare „extrem geschmeidig“ machen sollen für „sichtbar weniger Frizz“, „facettenreichem Glanz“ und einer „erhöhten Elastizität der Haarstruktur“. 

Die Behandlung hat circa 4 Stunden gedauert und das Ergebnis hinterher wirklich toll! Meine Haare haben sich so seidig und weich angefühlt wie noch nie und am liebsten wollte ich sie die ganze Zeit anfassen. Bezahlt habe ich dafür 450 Euro.

Umso höher war dann auch meine Erwartung, dass die Glättung für mehrere Monate hält. Dies hat leider nicht geklappt: schon nach 4 Wochen waren meine Haare wieder deutlich frizziger und der Glättungseffekt nur noch schwach zu sehen.

Vorher
Nachher

 

Das zweite Mal (zwei Jahre später) habe ich einen anderen Friseur ausprobiert, dieser hat Produkte von Goldwell Kerasilk benutzt. Nach der Keratin-Behandlung wird einem vom Friseur übrigens immer empfohlen, Shampoo und Conditioner aus der Produktlinie weiter zu nutzen, um den bestmöglichen Effekt und eine möglichst lange Glättung zu erzielen. Leider sind die Friseur-Produkte immer besonders teuer, daher habe ich meist nur jeweils ein Shampoo und einen Conditioner aus der Produktlinie gekauft und bin danach wieder auf normale Haarwaschmittel aus der Drogerie umgestiegen.

Auch nach dieser Keratin-Behandlung waren meine Haare wunderbar glatt, seidig und glänzend – jedoch auch wieder für nur einige Wochen und nicht wie versprochen für 3-6 Monate. Ich habe mir dieses Mal jedoch das speziell abgestimmte Shampoo und den Conditioner gekauft und beide ein Jahr lang benutzt und hatte den Eindruck, dass meine Haare auch nach einem Jahr noch eine ruhigere Struktur hatten und nicht mehr so buschig waren wie vorher. 

Keratin Glättung Friseur
Glatte Haare

Keratin-Glättung mit der xpress Kativa Keratin-Glättung für zuhause

 

Nachdem ich nun mehrere Keratin-Glättungen bei Friseuren ausprobiert hatte, war ich neugierig, ob eine Keratin-Glättung aus der Drogerie, welche man selbst zuhause anwendet, genauso gut funktioniert. Immerhin spart man damit mehrere hundert Euro.

Entschieden habe ich mich für die xpress Keratin-Glättung von Kativa, welche es bei Rossmann für circa 15 Euro zu kaufen gibt. Die Anwendung ist einfach und hat bei meinen langen Haaren 4 Stunden gedauert (also auch nicht länger als beim Friseur). Und das Ergebnis: WOW!! Exakt so glatt und seidig und weich wie vom Friseur, ich bin total begeistert!

Die spannende Frage ist nun, wie lange die Glättung anhält. Nach einem Monat merke ich nur einen minimalen Unterschied, der aber positiv ist: Direkt nach der Glättung sind die Haare nicht voluminös und liegen aalglatt und platt auf den Schultern. Jetzt nach einem Monat kommt das Volumen langsam zurück, aber noch sind sie genauso glatt wie anfangs 🙂 Ich werde das beobachten und jeden Monat ein neues Foto hier hochladen, um zu sehen wie lange die Glättung hält. 

Keratin Glättung Kativa xpress

Vorher

Meine Haare vorher: frizzig, buschig und mit unruhiger Struktur und trockenen Spitzen.

Keratin Glättung vorher

Nachher 

 

Und nach der Kativa xpress Keratin Glättung: glatt und super weich, gepflegte Spitzen und schöner Glanz. Etwas heller werden die Haare durch die Keratin Behandlung auch.

Keratin Glättung Kativa nachher Foto

Kativa xpress Keratin Glättung Anwendung

 

Die xpress Keratin Glättung von Kativa habe ich alleine zuhause durchgeführt und für die kompletten Haare etwa 4 Stunden gebraucht. Mit etwas Hilfe zu zweit geht der Prozess auf jeden Fall noch schneller.

Das Set enthält eine Anleitung, ein Paar Handschuhe, die Glättungscreme, ein spezielles Shampoo und eine Kur. Dazu benötigt man noch einen Föhn sowie ein Glätteisen, und schon kann’s losgehen!

Die Anwendung beinhaltet folgende Schritte:

Schritt 1: Die Haare mit dem im Set enthaltenen Shampoo waschen. Achtung: Nicht das gesamte Shampoo aufbrauchen, da die Hälfte noch ein zweites Mal benötigt wird. Danach die Haare komplett trocken föhnen.

Schritt 2: Die Glättungscreme auftragen und sorgfältig in die Haare einarbeiten und gleichmäßig verteilen. 15 Minuten einwirken lassen.  Danach wieder die Haare trocken föhnen.

Schritt 3: Dünne Strähnen abteilen und mit dem Glätteisen bei mindestens 180 Grad glätten. Dabei jede Strähne 8-12 Mal durch das Glätteisen ziehen.

Schritt 4: Anschließend die Haare mit dem restlichen Shampoo waschen und mit dem mitgelieferten Conditioner pflegen. Die Haare können nun geföhnt oder an der Luft getrocknet werden. Fertig!

Kativa Keratin Glättung
Kativa Keratin Glättung

Diese Fotos sind etwa eine Woche nach der Keratin Glättung entstanden und man kann gut erkennen, dass die Haare nicht komplett aalglatt sind, sondern noch einen leichten natürlichen Schwung besitzen, was mir sehr gut gefällt. Ein weiterer Vorteil der Keratin Glättung ist, dass die Haare danach viel schneller trocken werden und sofort schön liegen, ohne dass ich sie erst aufwändig stylen muss.

→ HIER kommst du zur Kativa Haarglättung bei Amazon!

Für wen eignet sich die Kativa Keratin Glättung?

 

Im Prinzip eignet sich die Keratin Glättung von Kativa für alle Haartypen – sei es lockig, wellig oder einach nur frizzig. Je ruhiger die Haarstruktur ist, desto glatter ist das Endergebnis. Da durch die Haarglättung die Haare leicht aufgehellt werden, ist bei gefärbten oder getönten Haaren Vorsicht geboten, da sich die Haarfarbe verändern kann! 

Pam Box August 2021 – Inhalt und Erfahrung mit der Überraschungsbox von Pamela Reif & Foodist

Pam Box August 2021 – Inhalt und Erfahrung mit der Überraschungsbox von Pamela Reif & Foodist

Pamela Reif, eine deutsche Fitness-Influencerin mit mehr als 6,5 Millionen Followern auf Instagram, hat Ende 2019 in Zusammenarbeit mit Foodist, bekannt für Abonnement-Lebensmittel-Boxen, die Pam-Box herausgebracht. Die  Pam-Box bringt dich auf eine vegane Entdeckungsreise und man kann super neue Produkte entdecken und ausprobieren. Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Ich habe die Box schon einige Male erhalten und mich nun entschlossen, über den Inhalt und meine Meinung dazu zu berichten. Am Anfang war ich von der Box total begeistert, aber zwischendurch war auch die ein oder andere Box dabei, deren Inhalt und auch das Preis-Leistungs-Verhältnis mich nicht ganz überzeugt haben. Hast du die Pam-Box auch schon ausprobiert und was hältst du allgemein von Lebensmittel-Boxen? Schreib es mir gerne in die Kommentare!

Konzept und Inhalt der Pam-Box

In jeder Pam-Box sind 6 bis 8 Produkte enthalten, darunter neben Superfood-Snacks, High-Protein-Riegel und Lebensmitteln zum Kochen auch Küchenutensilien oder nachhaltige Produkte, wie Bambus-Küchentücher oder Glas-Strohhalme. Der Gesamtwert der Box liegt laut Foodist bei mindestens 32 Euro. Die Pam Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Alle Produkte in der Pam-Box sind:

  • aus natürlichen Zutaten
  • 100 Prozent vegan
  • ohne raffinierten Zucker 
  • ohne künstliche Geschmacksverstärker
  • von Pamela getestet und empfohlen.

Zusätzlich enthält jede Box ein kleines Booklet rund um die Produkte, persönliche Tipps von Pamela und Rezepte.

Pam Box Juni 2021
Pam Box Februar 2021

Was kostet die Pam-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

 

Geheimtipp: Die Pam-Box kannst du verschenken! Hier wählst du zwischen Laufzeiten von 1 bis zu 12 Monaten, das Abonnement wird nach Ablauf nicht verlängert! So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. Wenn du die Box lieber selbst übergeben möchtest, kannst du aber auch deine eigene Adresse angeben.

Und pssst…wenn du die Pam-Box selber ausprobieren möchtest ohne ein Abo abzuschließen, dann wähle einfach die Geschenk-Option und bestell die Box zu dir nach Hause.

 

Wie häufig wird die Pam-Box geliefert?

Die Pam-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

Pam Box
Pam Box

ACÁO BIO koffeinhaltiges Getränk mit Grapefruit und Guarana

 

Biologisches Erfrischungsgetränk mit Grapefruit und Guarana Geschmack. Schmeckt mir persönlich sehr gut – wie eine kalte spritzige Limo. Für das i-Tüpfelchen noch in einem schönen Glas mit Eiswürfeln und frischen Himbeeren genießen! 🙂 

  • Inhalt: 250 ml
  • mit natürlicher Süße und natürlichem Koffein aus der Guaraná
  • vegan und kalorienarm

Hier nachkaufen: ACÁO BIO koffeinhaltiges Getränk mit Grapefruit und Guarana

LIVI’S KLEINE HELDEN BIO Dattel Fruchtkonfekt Kokos Kokos

 

Zwei süße Bio Bällchen gefüllt mit Kokos – erinnert mich mit der Schoko-Hülle etwas an Bounty. Schmeckt total lecker und cremig. 

  • Inhalt: 24 g
  • Dattel Fruchtkonfekt mit natürlicher Süße
  • vegan und palmölfrei

 Hier nachkaufen: LIVI’S KLEINE HELDEN BIO Dattel Fruchtkonfekt Kokos Kokos

VEGANNETT BIO Paprika-Olive Aufstrich mit Erdnuss- und Cashewmus

 

Der Paprika-Olive Bio-Aufstrich mit Erdnuss- & Cashewmus schmeckt pikant und gemüsig, und total lecker mit frisch geröstetem Brot. Aber auch zu Nudeln oder Ofengemüse passt der Aufstrich sehr gut, ein kleines Allroundtalent aus dieser Pam Box! 🙂 

  • Inhalt: 135 g
  • glutenfrei und ohne Konservierungsstoffe
  • vegan, sojafrei und palm(kern)ölfrei

Hier nachkaufen: Vegannett Paprika Olive Aufstrich

 

FOODIST BIO Rote Linsen

 

Pamela bleibt ihren Prinzipien treu – keine Pam-Box ohne (rote) Linsen. Manchmal pur, so wie in dieser Pam-Box, manchmal versteckt in Form von Nudeln oder auch knackigen Chips. Da rote Linsen sehr eiweißreich und gesund sind freue ich mich immer darüber. 🙂 

  • Inhalt: 500 g
  • bio und vegan
  • liefert Eisen, Folsäure, Zink und Magnesium

Hier nachkaufen: Foodist Essentials Rote Linsen

3BEARS Porridge „Genau richtig“

 

Gleich 5 unterschiedliche Sorten Porridge von der Marke 3BEARS sind in der Pam-Box enthalten, perfekt zum Durchprobieren. Da in der letzten Pam-Box ein Porridgeglas von 3BEARS drin war, kann man darin super Overnight Oats mit den Probierpackungen machen! Besonders lecker mit Joghurt und frischen Früchten dazu 🙂 

  • in nur 3 Minuten zubereitet
  • schmeckt warm oder kalt
  • ohne Zuckerzusatz, dafür mit pflanzlichem Eiweiß und Ballaststoffen

Hier nachkaufen: 3BEARS Porridge

CUPPER Flower Power Tea

 

Ein Bio-Kräutertee mit Holunderblüten, Hibiskusblüten & Kamillenblüten – ein interessante und leckere Mischung!

  • Inhalt: 20 Beutel
  • aus ökologischem Anbau
  • fruchtig-sanft

Hier nachkaufen: Cupper Flower Power Tea

SANTE Feste Erfrischende Gesichtsreinigung Bio-Aloe Vera & Chiasamen

 

Eine tolle nachhaltige feste Gesichtsreinigung, die man aufgrund der kleinen festen Form auch super mit auf Reisen nehmen kann. Schäumt gut und das Gesicht fühlt sich hinterher gut gereinigt an –  und ganz wichtig: das Gesicht spannt hinterher nicht 🙂 

  • seifenfreie Formel mit frischem Duft
  • 100% nachhaltig und komplett plastikfrei
  • sanfte und gründliche Reinigung

Hier nachkaufen: SANTE Feste Erfrischende Gesichtsreinigung Bio-Aloe Vera & Chiasamen

Meine Meinung zur Pam Box August 2021 – lohnt sie sich?

Die Pam Box für August 2021 gefällt mir sehr gut. Die Produktauswahl ist abwechslungsreich und passend zum Spätsommer – mit einem leckeren Getränk, fruchtigem Tee und einem leckeren Snack für unterwegs. Auch dass fünf Sorten Porridge zum Probieren dabei sind, finde ich gut um die Marke 3BEARS kennenzulernen. Diesmal waren gleich zwei nachhaltige Produkte mit dabei: die seifenfreie, plastikfreie feste Haarseife und das nachhaltige Salatbesteck. 

For Your Soul Box Juli 2021 – Inhalt der Foodbox von Stefanie Giesinger & Foodist

For Your Soul Box Juli 2021 – Inhalt der Foodbox von Stefanie Giesinger & Foodist

Foodist hat in Zusammenarbeit mit Model und Influencerin Stefanie Giesinger eine neue Foodbox herausgebracht mit dem schönen Namen „For your soul“-Box. Getreu dem Motto, sich ab und zu etwas Gutes zu tun und auf sich selbst zu achten, enthält die Box vegane, umweltfreundliche und leckere Produkte , auf die man sich regelmäßig freuen kann.

Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Konzept und Inhalt der For Your Soul-Box

In jeder For Your Soul-Box sind 6 bis 8 Produkte enthalten, darunter vegane Snacks und Kochprodukte, ein nachhaltiges Zubehör und eine Grußkarte. Die For Your Soul- Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Das Besondere: Pro Box wird 1€ an den Verein „Freunde fürs Leben“ gespendet, welcher Tabu-Themen wie Depressionen sichtbar macht und die Wichtigkeit von mentaler Gesundheit fokussiert.

 

For your soul box
For your soul box

Was kostet die For Your Soul-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung. Als kleines Extra ist die erste Box kostenfrei!

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung. Bonus: Ein 50€ Foodist-Gutschein!

 

Geheimtipp: Die For Your Soul-Box kannst du verschenken, indem du einfach die Adresse änderst!  So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. 

 

Wie häufig wird die For Your Soul-Box geliefert?

Die For Your Soul-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

For your soul box

Inhalt der For Your Soul-Box Juli 2021

Die For Your Soul-Box von Juli 2021 enthält folgende 8 Produkte (wenn du auf den Link klickst, kommst du zu dem Produkte bei Foodist):

Der Gesamtwert der Box liegt bei 30,60 Euro. Mit dem 12-Monats-Abo spart man somit sogar 4 Euro plus Versandkosten (im Vergleich dazu, wenn man sich die Produkte einfach so bei Foodist bestellen würde). 

LYCKA Bio Granola Kakao Brombeere

Lycka Granola

♥ schonend gebacken aus Vollkornhaferflocken ♥ sozial frühstücken: Lycka spendet einen Teil des Gewinns an soziale Projekte in Ostafrika!

Ich finde das Granola sehr lecker, es ist schön knusprig und nicht zu süß. Besonders gerne esse ich es zusammen mit Joghurt und frischen Blaubeeren für ein fruchtiges Frühstück 🙂

OAT MOELK Haferdrink Barista vegan

oat moelk

♥ vegan und ohne Zuckerzusatz ♥ besonders gut für Kaffee geeignet ♥ glutenfrei

Der Haferdrink schmeckt angenehm mild und ist gleich in meinen morgendlichen koffeinfreien Kaffee gewandert! 🙂 

FOODIST Peanut Butter mit Kokosnuss

FOODIST Peanut Butter mit Kokosnuss
FOODIST Peanut Butter mit Kokosnuss

♥ cremige Erdnussbutter mit Kokos ♥ ohne zusätzlichen Zucker ♥ ohne Palmöl

Ich liebe ja Erdnussbutter und hab mich daher sehr über diese neue Kreation gefreut – die ich zugegebenerweise wirklich löffeln könnte! Die Kombination aus Erdnussbutter und Kokos schmeckt unglaublich gut und passt super aufs Brötchen, Knäckebrot oder als Topping für das Porridge. Bisher mein absoluter Favorit! 

GET RAW Bio Snack No-Bake Crumble, Blaubeere & weiße Schokolade

GET RAW Bio Snack No-Bake Crumble, Blaubeere & weiße Schokolade
Katze in der Kiste

Wo ein Karton ist, ist auch die Katze nicht weit … smile

 

EAT REAL Hummus Chips Sour Cream Schnittlauch

EAT REAL Hummus Chips Sour Cream Schnittlauch

BOMBA Gewürztes Tomatenmark

 

schmeckt bestimmt super zu Pasta! 🙂

BOMBA Gewürztes Tomatenmark
BOMBA Gewürztes Tomatenmark

CANYA Koffeinhaltiges Getränk mit Calamansi und Birne

CANYA Koffeinhaltiges Getränk mit Calamansi und Birne

HALMIG Glasstrohhalme 20cm, 4er-Pack

HALMIG Glasstrohhalme 20cm, 4er-Pack
For your soul box

BIG EGO Cosmetics: LIL FAVOURITE & OH SO JELLY Testbericht

BIG EGO Cosmetics: LIL FAVOURITE & OH SO JELLY Testbericht

Gerade jetzt im Sommer sind meine Haare oft spröde, trocken und frizzig. Ist dann auch noch die Luftfeuchtigkeit hoch, ist kaum noch was zu retten und das Glätteisen ist mein liebster Freund. Da ich aber merke wie sehr es meinen Haaren schadet, bin ich schon lange auf der Suche nach einem Shampoo, das meine Haare bändigt und den Frizz vermindert. 

Auf dem Markt gibt es ein großes Angebot an Shampoos und Haarkuren, die angeblich den Frizz vermindern sollen, wie beispielsweise Frizz Ease von John Frieda oder Frizz Dismiss von Redken. Wirklich geholfen haben mir diese Produkte nicht, der Effekt hielt immer nur kurz an und schon am zweiten Tag nach der Haarwäsche sahen meine Haare aus wie vorher.

Da kam es genau richtig, dass Model und Influencerin Kristina Levina eine eigene Haarpflegeserie mit der eigenen Marke „Big Ego Cosmetics“ herausgebracht hat. Mit dabei: Ein Shampoo („lil favourite“), einen Conditioner („oh so jelly“) und jede Menge Haaraccesoires, wie beispielsweise Haarspangen in Schmetterlingsform. 

Ich habe mir gleich das Shampoo und den Conditioner bestellt, da beide Produkte aufeinander abgestimmt sein sollen und sich perfekt ergänzen sollen. Die Haare sollen nach der Haarwäsche seid weich sein, mit Feuchtigkeit gepflegt und sich samtig anfühlen. Da bin ich mal gespannt!

 

BigEgo Cosmetics

Über Big Ego Cosmetics

 

Zuallerest teile ich ein paar Infos über Big Ego Cosmetics mit euch. Die Marke wurde 2021 von Influcencerin Kristina Levina gegründet (hier kommt ihr zu ihrem Instagram Account). 

Auf der Website findet man neben dem Shampoo und dem Conditioner noch Haar-Accessoires und Haargummies. Die Website bigegocosmetics.de und auch die Produkte sind sehr „girly“ gehalten in den Farben rosa und weiß, was mir persönlich aber sehr gut gefällt. 

Alle Produkte sind tierversuchsfrei und werden innerhalb Deutschlands entwickelt, hergestellt und abgefüllt. Sie sind vegan und enthalten kein Soja. Big Ego Cosmetics vewendet keine Parabene und Sulfate und sind für alle Hauttypen verträglich. Die Produkte sind außerdem dermatologisch getestet

 

BigEgo Cosmetics
BigEgo Cosmetics

Big Ego – LIL FAVOURITE Shampoo

 

Das Shampoo LIL FAVOURITE ist ein „Balancing Shampoo for oily roots & sensitised lenghts“ und enthält 200ml. Momentan ist das Shampoo für 29,00 Euro erhältlich und zählt damit schon zu den teureren Shampoos.

Laut Big Ego Cosmetics ist die Rezeptur des Shampoos besonders mild und rein planzlichen Ursprungs. Das Shampoo enthält keine Duftstoffe, die Basis bildet Nusskernöl, Kokosöl und Maiskeimöl.

Das kann das Shampoo:

  • Weizenprotein sorgt für eine gute Kämmbarkeit und schützt vor äußeren Einflüssen wie Sonne oder Hitzeeinwirkung durch Föhnen/Glätten.
  • Papaya-Extrakt schützt ebenfalls vor Umwelteinflüssen, beruhigt die Kopfhaut und gibt Elastizität.
  • Panthenol (Vitamin B5) spendet den Haaren Feuchtigkeit, beruhigt ebenfalls die Kopfhaut sorgt für ein weiches Haargefühl.
  • Glycerin beugt Splissbildung vor und spendet Feuchtigkeit für Kopfhaut und Haare.

Des Weiteren ist das Shampoo LIL FAVOURITE vegan, silikon- und parabenfrei, PEGfrei, mineralölfrei und ohne Farbstoffe.

 

BigEgo Cosmetics
BigEgo Cosmetics
Inhaltsstoffe LIL FAVOURITE Shampoo mit Bewertung
InhaltsstoffWirkungBewertung Hautschutzengel
WasserHauptbestandteil neben waschaktiven Substanzenempfehlenswert
Sodium Cocoamphoacetate (pflanzliches Kokostensid)schaumstabilisierend, reinigend, sanftere Alternative zu Sodium Lauryl Sulfaten.empfehlenswert
Lauryl Glucoside (Tensid pflanzlichen Ursprungs) Mild und gut geeignet für empfindliche Kopfhaut. Biologisch abbaubar und umweltverträglich.empfehlenswert
Disodium Cocoyl Glutamate (Tensid pflanzlichen Ursprungs)mild und hautfreundlich, schaumbildend. Biologisch abbaubar und damit gut umweltverträglich.empfehlenswert
Sodium Lauryl Glucose Carboxylate (Tensid pflanzlichen Ursprungs)Hohe Reinigungskraft, biologisch abbaubar und gut geeignet für empfindliche Haut.empfehlenswert
Cocamidopropyl Betaine (Tensid pflanzlichen Ursprungs)Verbesert die Kämmbarkeit der Haare, wirkt antistatisch und ist gut verträglich.empfehlenswert
Glycol Distearate (Emulgator)glättend, geschmeidig machend.empfehlenswert
Coco Glucoside (Tensid pflanzlichen Ursprungs)gut schäumend, gut verträglich. Wird oft in Naturkosmetika eingesetzt.empfehlenswert
Glyceryl Oleate (Emulgator pflanzlichen Ursprungs)macht die Haare geschmeidig. Biologisch abbaubar, gut umweltverträglich.empfehlenswert
Glycerinspendet und bewahrt Feuchtigkeit, wirkt glättend.empfehlenswert
Lauryl Lactatemacht geschmeidig, bewahrt Feuchtigkeit.empfehlenswert
Carica Papaya Fruit Extract (Papaya Extrakt)pflegend, regenerierend, stärkend, antibakteriell.empfehlenswert
Hydrolyzed Wheat Protein (Weizenkeimprotein)antistatisch und feuchtigkeitsspendend.empfehlenswert
Panthenolfeuchtigkeitsbewahrend, regenerierend, beruhigend. Gut hautverträglich.empfehlenswert
Citric Acid (Zitronensäure)reguliert den pH-Wert, schützt vor Umwelteinflüssen, reduziert Frizz.empfehlenswert
Laureth-4 (PEG-Derivat)Allergie- und Reizungspotenzial, schwächt Hautbarriere,  Verunreinigung/ Bildung von Nitrosaminen möglich, die krebserregend wirken.bedenklich
Phenoxyethanol (Konservierungsmittel)Kann Hautbarriere angreifen und zu andauernden Hautreaktionen führen (Reizungen, Rötungen, Pickel, Entzündungen), Reizungs- und Allergiepotenzial, möglicherweise toxisch/ gesundheitsschädlich wirkend auf Blut und Leber. In Leave-In Produkten, die nicht abgewaschen werden, sogar verboten.bedenklich
Ethylhexylglycerin (Konservierungsmittel)Kontaktallergische Reaktionen wie Dermatitis möglichleicht bedenklich
BigEgo Cosmetics
BigEgo Cosmetics

Big Ego – OH SO JELLY Conditioner

 

Der Conditioner OH SO JELLY ist ein „strenghtening anti-breakage jelly leightweight conditioner“ und für 29,00 Euro erhältlich. Durch die „Jelly“ Textur lässt sich der Conditioner leichter verteilen, zieht schnell ein und lässt sich gut auswaschen. Besonders für trockene und strapazierte Haare ist der Conditioner gut geeignet.

Genauso wie das Shampoo enthält der Conditioner Weizenprotein, Glycerin, Panthenol und Papaya-Extrakt. Außerdem ist der Conditioner silikon- und parabenfrei, PEGfrei, tierversuchsfrei, mineralölfrei, vegan und ohne Farbstoffe.

Da der Conditioner sehr konzentriert ist, reicht wenig Produkt aus. Dieses wird in die nassen Haare eingearbeitet und nach kurzer Einwirkzeit wieder ausgespült.

BigEgo Cosmetics
BigEgo Cosmetics
Inhaltsstoffe Oh so jelly
InhaltsstoffWirkungBewertung Hautschutzengel
AquaHauptbestandteil neben pflegenden Substanzenempfehlenswert
Cetyl AlcoholKonsistenzgeber, sorgt für geschmeidiges Haarempfehlenswert
Behentrimonium Chloridesorgt für glänzendes, weiches Haar und gute Kämmbarkeitleicht bedenklich
Carica Papaya Fruit Extract (Papaya Extrakt)pflegend, regenerierend, stärkend und antibakteriellempfehlendwert
Hydrolyzed Wheat Protein (Weizenkeimoritein)antistatisch und feuchtigkeitsspendendempfehlenswert
Panthenolregenerierend, beruhigend, gut hautverträglichempfehlenswert
Parfum (Duftstoff)sorgt für angenehmen Duftunbekannt
Limonene (Duftstoff pflanzlichen Ursprungs)sorgt für angenehmen Duftempfehlenswert
Citronellol (Duftstoff pflanzlichen Ursprungs)sorgt für angenehmen Duftempfehlenswert
alpha-isomethyl Ionone (Duftstoff synthetischen Ursprungs)kann allergie Reaktion hervorrufen und die Haut irritieren, umweltrelevantleicht bedenklich
Citric Acid (Zitronensäure)reguliert den pH-Wert, schützt vor Umwelteinflüssen, reduziert Frizzempfehlenswert
PhenoxyethanolKann die Hautbarriere angreifen und zu andauernden Hautreaktionen führen (Reizungen, Rötungen, Pickel, Entzündungen), Allergiepotenzial, möglicherweise toxisch/ gesundheitsschädlichbedenklich
Ethylhexylglycerin (Konservierungsmittel)Kontaktallergische Reaktionen wie Dermatitis möglichleicht bedenklich

 

Kleiner Hinweis: Viele Inhaltsstoffe, die als „empfehlenswert“ eingestuft sind, können trotzdem ein leichtes bis hohes Allergierisiko aufweisen. Am besten einfach nachlesen, wenn bei einem Inhaltsstoff Unsicherheit besteht, da ich es nicht zu jedem einzelnen herausgesucht habe!

BigEgo Cosmetics

Big Ego Cosmetics – Produkttest

So, nachdem ich so viel über das Shampoo und den Conditioner von Big Ego berichtet habe, möchte ich natürlich auch zeigen, wie meine Haare nach dem Waschen mit den Big Ego Produkten aussehen.

Dafür habe ich meine Haare einmal vor dem Waschen fotografiert, dann nach dem Waschen mit meinem üblichen Shampoo aus der Drogerie und dann nach der Haarwäsche mit den Produkten von Big Ego.

1. Foto: Vor der Haarwäsche

2. Foto: Nach der Haarwäsche mit einem normalen Shampoo

3. Foto: Nach der Haarwäsche mit den Big Ego Produkten (Shampoo und Conditioner)

Haare vor dem Waschen
Nach dem Haarewaschen
Nach dem Haare waschen mit Big Ego

Ich finde man kann gut erkennen, dass die Produkte von Big Ego einen Unterschied machen, wenn auch keinen allzu großen. Aber der große Unterschied kommt warscheinlich eher mit regelmäßiger Anwendung, daher werde ich nochmal berichten, nachdem ich die Produkte einige Wochen angewendet habe.

Nach der Haarwäsche mit einem normalen Shampoo sind meine Haare total „aufgeplustert“, strohig und sehr trocken. Die Spitzen fühlen sich fast schon strohig an und allgemein sind die Haare sehr buschig. 

Nach der Anwendung mit den Prokten von Big Ego Cosmetics sind meine Haare weniger buschig, fühlen sich weicher an und sind auch etwas glatter.

Meine Erfahrung mit Big Ego Cosmetics

 

Ich finde das Shampoo und den Conditioner richtig gut! Fast gar keine schädlichen Inhaltsstoffe, viele pflegende Komponenten und sogar keine Duftstoffe im Shampoo. Das geht schon fast in Richtung Naturkosmetik.

Da der Conditioner Duftstoffe enthält (unter anderem Citrusduft), riechen die Haare nach der Anwendung trotzdem sauber und frisch. Und genau so fühlen sie sich auch an! Beim Shampoo ausspülen „quietschen“ sie richtig (was sie bei mir nicht bei jedem Shampoo machen) und nach dem Föhnen sind sie glatter und weniger frizzig als sonst. Das Shampoo riecht übrigens wirklich nach nichts, dafür hat der Conditioner einen angenehmen fruchtigen Duft. 

Etwas teuer finde ich den Preis, für beides zusammen zahlt man 60 Euro, eine Flasche enthält jedoch nur 200ml und reicht besonders bei langen Haaren nicht allzu lange. Aber da die Marke gerade erst am Anfang steht, ändert sich der Preis ja vielleicht auch noch.

10 von 10 Punkten würden die beiden Produkte bekommen, wenn auch für die schädlichen Inhaltsstoffe geeignete Alternativen verwendet worden wären.

Das Design gefällt mir übrigens sehr gut, schön schlicht, clean und trotzdem ansprechend.

Meine Haare sehen zwar nicht aus wie nach dem Friseur, aber ich freue mich, dass wenigstens ein kleiner Unterschied erkennbar ist. Ob der Unterschied nach regelmäßiger Anwendung noch größer wird und meine Haare insgesamt noch weniger frizzig sind, werde ich berichten. 🙂 

Hier ist nochmal der Link zum Shop: bigegocosmetics.de.

BigEgo Cosmetics
BigEgo Cosmetics

Neben dem Shampoo und dem Conditioner habe ich mir noch ein paar Scrunchies dazu bestellt. Die Farben gefallen mir mega gut und da die Scrunchies aus Seide sind, sehen sie schick und edel aus und sind gut für die Haare. Es entsteht weniger Haarbruch und die Haare werden geschont.

Big Ego Cosmetics
Big Ego Cosmetics

Die Scrunchies sind übrigens in hübschen kleinen, wiederverschließbaren Tütchen verpackt, was zwar süß aussieht, aber ob die Tütchen auch nicht vermeidbarer Verpackungsmüll sind? 

Big Ego Cosmetics
Big Ego Cosmetics

Besonders das große, weiße seidene Scrunchie finde ich besonders schön und es erinnert mich an eine elegante Hochzeit in weiß. Ich trage es oft im Büro und habe ein paar Fotos zur Inspiration gemacht, mit welchen Frisuren man das Scrunchie tragen kann. 🙂 

Big Ego Cosmetics
Big Ego Cosmetics

» Hier findest du die Scrunchies von Big Ego:

Silk Scrunchie groß (20 Euro) und

Silk Scrunchie klein 5er-Pack (25 Euro)

 

 

» Günstigere Alternativen von Amazon:

Silk Scrunchie groß (10 Euro) und

Silk Scrunchie klein 2er-Pack (13 Euro)

Pam Box Juni 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pam Box Juni 2021 – Inhalt und Fazit zur Überraschungsbox von Pamela Reif & Foodist

Pamela Reif, eine deutsche Fitness-Influencerin mit mehr als 6,5 Millionen Followern auf Instagram, hat Ende 2019 in Zusammenarbeit mit Foodist, bekannt für Abonnement-Lebensmittel-Boxen, die Pam-Box herausgebracht. Die  Pam-Box bringt dich auf eine vegane Entdeckungsreise und man kann super neue Produkte entdecken und ausprobieren. Besonders mag ich, dass die Box jedes Mal wieder eine Überraschung ist weil man nie weiß, was sich darin befindet – sowas mag ich total gerne. Die Box eignet sich für alle, die einen gesunden und ausgewogenen Lebensstil führen und gerne neue Produkte ausprobieren.

Ich habe die Box schon einige Male erhalten und mich nun entschlossen, über den Inhalt und meine Meinung dazu zu berichten. Am Anfang war ich von der Box total begeistert, aber zwischendurch war auch die ein oder andere Box dabei, deren Inhalt und auch das Preis-Leistungs-Verhältnis mich nicht ganz überzeugt haben. Hast du die Pam-Box auch schon ausprobiert und was hältst du allgemein von Lebensmittel-Boxen? Schreib es mir gerne in die Kommentare!

Konzept und Inhalt der Pam-Box

In jeder Pam-Box sind 6 bis 8 Produkte enthalten, darunter neben Superfood-Snacks, High-Protein-Riegel und Lebensmitteln zum Kochen auch Küchenutensilien oder nachhaltige Produkte, wie Bambus-Küchentücher oder Glas-Strohhalme. Der Gesamtwert der Box liegt laut Foodist bei mindestens 32 Euro. Die Pam Box gibt es bereits ab 26,90 € pro Box im Jahresabonnement.

Alle Produkte in der Pam-Box sind:

  • aus natürlichen Zutaten
  • 100 Prozent vegan
  • ohne raffinierten Zucker 
  • ohne künstliche Geschmacksverstärker
  • von Pamela getestet und empfohlen.

Zusätzlich enthält jede Box ein kleines Booklet rund um die Produkte, persönliche Tipps von Pamela und Rezepte.

Pam Box Juni 2021
Pam Box Februar 2021

Was kostet die Pam-Box?

Aktuell kannst du zwischen drei verschiedenen Abo-Varianten wählen. Die Versandkosten sind schon im Preis inbegriffen.

Variante 1: „Flexibel“ – 29,90 € pro Box, 2-Monats-Rhythmus, monatlich kündbar.

Variante 2: „6 Monate“ – 3 Boxen, 28,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

Variante 3: „12 Monate“ – 6 Boxen, 26,90 € pro Box, 2-Monats-Rhythmus, automatische Verlängerung.

 

Geheimtipp: Die Pam-Box kannst du verschenken! Hier wählst du zwischen Laufzeiten von 1 bis zu 12 Monaten, das Abonnement wird nach Ablauf nicht verlängert! So kannst du deine Lieben überraschen, indem du die Box direkt zu ihnen nach Hause bestellst. Wenn du die Box lieber selbst übergeben möchtest, kannst du aber auch deine eigene Adresse angeben.

Und pssst…wenn du die Pam-Box selber ausprobieren möchtest ohne ein Abo abzuschließen, dann wähle einfach die Geschenk-Option und bestell die Box zu dir nach Hause.

 

Wie häufig wird die Pam-Box geliefert?

Die Pam-Box wird alle 2 Monate zu dir nach Hause geliefert, immer zur Mitte des Monats. Wenn dir die Produkte aus der letzten Box gut gefallen haben, kannst du sie übrigens ganz bequem bei Foodist.de nachbestellen.

Inhalt der Pam Box Juni 2021

Die Pam Box von Juni 2021 enthält folgende 6 Produkte:

Damit liegt der Gesamtwert der Pam Box Juni 2021 bei  34,50 Euro und übersteigt damit den Mindest-Gesamtwert der Box, welcher bei 32 Euro liegt.

 

Pam Box Juni 2021
Pam Box Juni 2021

PAKKA Bio Cashews geröstet mit Meersalz

 

Leicht gesalzene Cashewkerne als gesunder Snack für zwischendurch. Mag ich persönlich total gerne!

  • Inhalt: 100g
  • fair gehandelt aus Burkina Faso
  • mit Meersalz gesalzen

Zutaten: Cashews 98.7%, Salz 1.2%, Gummi Arabicum.

Hier nach den Cashews stöbern:

Foodist Pakka Cashews

➤ Alternative: Bio Fairtrade Cashewkerne mit Curry & Meersalz

Pam Box Juni 2021

YOGI TEA Bio Teekaltgetränk Ingwer & Zitrone

 

Den Yogi Tea Ingwer&Zitrone kannte ich vorher nur als „normalen“ Tee und war echt (positiv) überrascht, dass es den Tee auch als Kaltgetränk gibt! Sehr erfrischend und passt perfekt für heiße Sommertage 🙂 

  • Inhalt: 330 ml
  • mit Zitronengras, Hibiskus und Krauseminze
  • ohne Zusatzstoffe

Zutaten: Aufguss von Kräutern und Gewürzen (Wasser, Ingwer*, Süßholz*, schwarzer Pfeffer*, Pfefferminze*, Zitronenschale*, Zitronengras*, Hibiskus*, Krauseminze*)(92,5%), Agavendicksaft* (4,5%), Zitronensaft* (2,5%), Ingwersaft* (0,5%).
*aus kontrolliert biologischem Anbau

Hier nach dem Yogi Tea stöbern:

Foodist Yogi Tea 

➤ Alternative: Carpe Diem Kombucha Zitrone-Ingwer

 

Pam Box Juni 2021

BLUE FARM Haferdrink Pulver

 

Haferdrink zum selber anrühren? Das habe ich sofort ausprobiert und es klappt echt gut! Das Pulver ist sehr ergiebig und reicht für bis zu 4 Liter. Super daran finde ich, dass diese Alternative zu Hafermilch in Verpackungen viel Verpackungsmüll spart und umweltfreundlich ist.

  • Inhalt: 375g
  • gluten- und laktosefrei
  • ohne Zucker

Zutaten: Hafer, Salz.

 

Hier nach dem Haferdrink Pulver stöbern:

Foodist Haferdrink Pulver

➤ Alternative: AlpenPower BIO TRINKHAFER

Pam Box Juni 2021

CLEVER PASTA Rote Linsen Nudeln

 

Nudeln mag ich, rote Linsen weil sie so gesund sind auch – deshalb habe ich mich eigentlich über die Rote Linsen Nudeln gefreut. „Eigentlich“ deshalb, weil in der letzten Pam Box von April 2021 schon Nudeln drin waren und ich meine mich zu erinnern, kein Nudel-Abo bestellt zu haben..naja aber gottseidank kann man gute Pasta ja immer gebrauchen! 🙂

  • Inhalt: 250g
  • glutenfrei und proteinreich
  • in nur 4 Minuten fertig

Zutaten: Rotes Linsenmehl (89%), Wasser.

Hier nach der Rote Linsen Pasta stöbern:

Foodist Rote Linsen Pasta

➤ Alternative: Barilla Fussili Rote Linsen

Pam Box Juni 2021

BAETTER BAKING Bio Backmischung für Haferkekse

 

Diese Pam Box regt wirklich zum Selbermachen kann – neben Hafermilch zum selbst anrühren ist nun eine Backmischung für Haferkekse dabei (ich glaube bei der Auswahl hat Pam der Hafer gestochen :D). Spaß beiseite: Die Backmischung ist perfekt, wenn’s man schnell gehen muss und man trotzdem gerne etwas selbst gebackenes haben möchte. Und gesund noch dazu! Aber aufpassen: Bananen, Ahornsirup und Öl musst du selbst dazugeben.

  • Inhalt: 300g (reicht für 18-20 Kekse)
  • glutenfrei und vegan
  • mit natürlicher Süße

Zutaten: Hafervollkornmehl* (41*), Hafervollkornflocken* (21%), Kokosraspeln* (13%), Dattelwürfel* (Datteln*, Reismehl*), Leinsaat*, Mandeln* (5%), Kürbiskerne* (5%), Zimt*, Meersalz.
*aus kontrolliert biologischem Anbau

Hier nach der Haferkeks-Backmischung stöbern:

Foodist Haferkeks Backmischung

➤ Alternative (für alle die sofort Knuspern wollen): Bauckhof Bio Hafercookies

Kleiner Tipp: Beim Stöbern auf baetterbaking.com habe ich noch weitere Backmischungen entdeckt, die du sogar bei Amazon bestellen kannst, beispielsweise die glutenfreie Pancakes-Backmischung und die Brownie-Backmischung mit Kokosblütezucker.

Pam Box Juni 2021

3BEARS Overnight Oats Glas

 

Das Overnight Oats Glas kommt gerade richtig für ein leichtes, gesundes Frühstück im Sommer, am Abend zubereitet und morgens verzehrfertig aus dem Kühlschrank. Ich bin totaler Fan davon und hab gleich mein Lieblingsrezept ausprobiert – Overnight Oats mit frischen Erdbeeren und Rohkakao-Topping (noch aus der Pam Box von April). So lecker!

  • umfasst 410 ml
  • mit Deckel, spülmaschinenfest
  • perfekt zum Mitnehmen
  • mit Füllstrichen, um das richtige Verhältnis von Haferflocken und Flüssigkeit abzupassen

Jetzt nach dem Overnight Oats Glas stöbern:

Foodist Overnight Oats Glas

➤ Alternative von Amazon: Kilner Frühstück To-Go-Glas

Pam Box Juni 2021

Meine Meinung zur Pam Box Juni 2021 – lohnt sie sich?

 

Meine Meinung zur Pam Box Juni 2021 ist tatsächlich etwas zwiegespalten. Einerseits sind super gesunde Alternativen zu herkömmlichen Süßigkeiten dabei, so wie die Backmischung für die Haferkekse und die Cashewnüsse. und besonders das Haferdrink-Pulver hat es mir angetan, da es nur aus zwei Zutaten besteht und Verpackungsmüll spart.

Andererseits hätten die Rote Linsen Nudeln nicht sein müssen (meine persönliche Meiung), da in der Pam Box von April 2021 schon eine große Packung Kichererbsen-Nudeln drin war. Da hätte ich mir mehr Abwechslung gewünscht! Vielleicht startet Pam ja eine heimliche Kampagne für Nudeln aus Hülsenfrüchten und gegen Getreide-Nudeln 😀

Über das Overnight Oats Glas habe ich mich sehr gefreut, da ich gerne Porridge esse und dieses auch oft zur Arbeit mitnehme, bisher immer in alten Marmeladengläsern. Das Glas von 3Bears sieht dann aber doch schicker aus und gerade die Füllstriche finde ich total praktisch, um das richtige Verhältnis von Haferflocken und Flüssigkeit zu treffen. Nur den Preis von fast 8 Euro finde ich dann doch etwas viel für ein Glas mit Deckel.